Identifiers and Description

Gene Model Identifier

Contig3320.0.g49

Standard Name

DSRBD3

Aliases

Contig3320_0_g49

Description

Double-stranded RNA binding motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam00035 ) Double-stranded RNA binding motif

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3320.0.g49(coding)
ATGCTTGACACAATTGAACTCCCCGAGGACTGGTACAAAATCTACATCAACAAGCAGCAA
ATGGTTTATGTTAATGTAAGAGACCAAATTTGCTCAGTGGGCCCTGTTTTCAGCATTTCC
AAGATAGACCAAGTATTCAATGGAATCTTGGGCCTGAAAGTTGACCACTAAAAGATTGAG
TAAGAGGTTGAGAGAGTGCGCAAAACTTTAAACTTAATGTGCAACACTCACCCACTTCTG
GACCTCAATGAAAACTCCTTGGTTTCCACTATGAACTCACAAACTCTCGGTGCAGATGGA
GAAATTGATGAGAAACTTTTGGATTCCACACAGCTCTCACTTTTGCTACAACAGAGAGAA
AATTTGAGAATCAATAATGAGCTGGACAAGCAAGTGGAAGAGCTGGATTTGAGGATTCAG
GCTGAGCTTAAAGATATTGTCGGTGACAACAAAGATGAAGTCTCGCTTTTGAATGAGATC
ACTGGCAAATTCTTTTAGGGCATTCCGCAATACTCGCATCATGAGCAATCTACTGAGAAT
CCTATGTTAAGGTTCTACTGCTCAGTAAGAGTAAATGGCAGAGAAGTGGGAAGAGGAGTC
GCTCAGAACAAAAAGCATGCAAAGCAGCTTTCAGCAATCCAAGCACTAAAGAACATCTGC
CCTAACCTCTATTCCCAATGGAAAGTCAAGTACAGAGATCAAGAGAGTGCAGTTTCAAGC
CAATCATAGCCTGGCAGCCACTTCCTCAAGGAAATTGACCTGGGTTCACTCATGTAACAA
GCCAGCTAGAAAGGCCTCATACCTGCAATGAAACCAGGCAAAGAGAATCAGCAGCAATTG
TCTTAAAATTCAAAGGACAGCTCTCAACCAGGATATTCTCAGGATGCAGTGAGCACTCAA
GATATCGATGATGCTGAAATCGATGACCCTGAACTAATGTACTCCAAGAAGCATCTCTGT
GCAAAGTATACCCCACTTACTGTTGTGAAAACTTTGGAAGCTAAGCACAAGAACCTGAGC
TTCATTGAGCAAATTAATGAGTCCAAAGATCTTGTGAAAAACAAAAATGTCTACACAATT
ATCTTCTCAATTAGAGGTTTCAATCTCGAAGGAAGAGCAACTGATTACAGCAAGCAAAGA
GCTAGACATGAGGCATCCCAAAGATTCCTCAAAAACCTCTTCCCTAAGAATTACACATGG
AATTGTGTAATATCTCAACTCACCTAACTCAAAGAACCACTAAAAGAAATACTTGATCTT
GATTGA


>Contig3320.0.g49(protein)
MLDTIELPEDWYKIYINKQQMVYVNVRDQICSVGPVFSISKIDQVFNGILGLKVDHQKIE
QEVERVRKTLNLMCNTHPLLDLNENSLVSTMNSQTLGADGEIDEKLLDSTQLSLLLQQRE
NLRINNELDKQVEELDLRIQAELKDIVGDNKDEVSLLNEITGKFFQGIPQYSHHEQSTEN
PMLRFYCSVRVNGREVGRGVAQNKKHAKQLSAIQALKNICPNLYSQWKVKYRDQESAVSS
QSQPGSHFLKEIDLGSLMQQASQKGLIPAMKPGKENQQQLSQNSKDSSQPGYSQDAVSTQ
DIDDAEIDDPELMYSKKHLCAKYTPLTVVKTLEAKHKNLSFIEQINESKDLVKNKNVYTI
IFSIRGFNLEGRATDYSKQRARHEASQRFLKNLFPKNYTWNCVISQLTQLKEPLKEILDL
D