Identifiers and Description

Gene Model Identifier

Contig16493.0.g118

Standard Name

DSRBD2

Aliases

Contig16493_0_g118

Description

Double-stranded RNA binding motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam00035 ) Double-stranded RNA binding motif

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16493.0.g118(coding)
ATGAACTTAGAACTCATCAATCCATTAGAGTTACCCTAATCTATATTTGACATTCCCCAA
TTTAAAGAGTTTTTGGATGAAGAGCTGGAAAGAAAGCACCCTTGTAGTATTTTGGATGAG
ACTTTGAAAAAGATACAGTTACTCCCGCCCAAATACGAATTTATTAGCCAAGAAATTAAT
AGGAAATAAGAAATAGAATTTACTTGTCAATGTCAAATTGAGGAACTAGCTGCATACTAT
CATGGTAAAGGAAAGAATAAAAAAGTTGCAAAAAGTATGGCAGCAAAAGAGGCTATAATT
GCGCTAGCTGCTTTGCCTGACGTACAAAAAGTACTGATTTCAATAATGATGAGTGCTAAT
ATGAACGATACTTTTTTACTAGGGGGATTAAGCGGAGGTCCTAGTAAAAAACGAGCAAAG
AGATCCTAAGATTAGATATTTTTACCATAGAACTTCAATACCAATTTTCCTTAAATAAGT
ACTCATCAAAAGACTGCAGTACCATTCTAGATTTAAAGTACTACATCATCAGACTTATTT
GAGAATAATTTCAGTCTTTCTCAATAAAATTAGCTAACTATACCATAATCATAGAATGTT
TCAACTCTTCAAGCTTCAAACTCTCGTATTAACAAATAAGCAGCAGATAGATTCATTTTC
AACCATCTTGGCACCTCTAAACATGAAATGACCGCACAAAACTAAAAATAACAAGAAAAA
CCTATAATTTCTCAAAGCTCTCATAGGACAGTCACATAAGCTTTAACACATTCAAAACCA
TAGGAAGAATTATGTACAAATGAAGACTTAGAAAAAGCCGAATAAATAAAGTTAATTTTT
AAGAAAATTTAAGAATGGGCTGACCAGAAGAAATAAAAATATGTATTTTAGGATGCTCCA
TGTGATACCTAGGGATGGTTTAAGAAGTAGCTTTACTTTGAAAATGATTTATTAGGAGTT
GGGGAGGCTACAACATAGCGCAAAGCCAAGATTTTATGCGCTAAATAAGCTTTAGAAAAT
TTAGAAGCTGGGAAAGTTATGCCAAAACCTTGTTCCAAAAATGGGCTCATAGAATTTCTG
AGATAGAAAAATGATCTCAAAAGTATGTTAATATCTGATCCTGATGAGTAAATTGCTCAG
TAACAATAGTACTACGAATAACAAAAAAAGCTAGAAGAGGAGCTTGAAGAGTAAAAACGT
TAAGAAGAGCAAGAATTGGAAAAACGTAAAAAACGTGAAGAAAAAGAGCATTAACGATTG
TAGTAACTTTAATAAAAAAATGACGAAAAAAAGAAGCAAAAAGAAGAAAAGCGAAAACTC
AAGGAGCTCAAAATTTAAGAAAAATTAATGGAGAAAGAACGAAAGAGATAAGCTAAAATA
TAGGAAAAACGAGAGATTGCTATATAGAAATATACTGTATCACTAGAGGAGTAGGGTATG
TTTGAAGCTTATGTTTTGTTAAGGTCCACTGAGCTATAGCTTTTGATGGAGGATTAATAT
GATTTTGTAAAGTTTATTCTTAAAATTCAAGAACTTAAACCTAAACTCGAAGAAATTGGG
ATATTAAACATTATTCCAGTCGGCTCCGCTACTAATAAAACCATAAGACGAGATTACTTT
ATGATGGACATTATTATGAATTATAATAAGACAATAATAACACATGACGAAAATAAGGTA
CTATAAAATCCTGATTAGCAGAGAAGACTTTTCGATAACATAATTGAAAATTTATCGACA
ATAATCAAATAGGAATTTACCAGCCCAAATTATTTCGTGAGTAGTGGTTAGCTATACATT
GAAAATTAAGGTAAACCAATCTACGAGGTTTTTAGCGACACTTCTGGTGATGGTATTGAA
TCCCCTTATTTAGCTTAAGTTAAACTTATAAATACAATTGACCAGACAAAGCTCAATGCA
AGATTCTTTGTTTAAGAACTTCACCAGCATGATACTTTTTACAGCATAAAGCATTGGTTT
GATATGCAGAGAACATTAAGAGAGGATGTGAAATTTCATGCTGTACAACGCGTACTTAAA
CAATGGCGATTTTTTCATGATTTAGCAAATTTCCTATATCCTGAGGTGCTGGACAGTGTT
TTGTTAATGTGTGTGAAAAATAAAGAAAGCCTCGATGATTGCCTGGGTGCTTCTATTGTA
AGTATTTCTTGGGAGTTTTGA


>Contig16493.0.g118(protein)
MNLELINPLELPQSIFDIPQFKEFLDEELERKHPCSILDETLKKIQLLPPKYEFISQEIN
RKQEIEFTCQCQIEELAAYYHGKGKNKKVAKSMAAKEAIIALAALPDVQKVLISIMMSAN
MNDTFLLGGLSGGPSKKRAKRSQDQIFLPQNFNTNFPQISTHQKTAVPFQIQSTTSSDLF
ENNFSLSQQNQLTIPQSQNVSTLQASNSRINKQAADRFIFNHLGTSKHEMTAQNQKQQEK
PIISQSSHRTVTQALTHSKPQEELCTNEDLEKAEQIKLIFKKIQEWADQKKQKYVFQDAP
CDTQGWFKKQLYFENDLLGVGEATTQRKAKILCAKQALENLEAGKVMPKPCSKNGLIEFL
RQKNDLKSMLISDPDEQIAQQQQYYEQQKKLEEELEEQKRQEEQELEKRKKREEKEHQRL
QQLQQKNDEKKKQKEEKRKLKELKIQEKLMEKERKRQAKIQEKREIAIQKYTVSLEEQGM
FEAYVLLRSTELQLLMEDQYDFVKFILKIQELKPKLEEIGILNIIPVGSATNKTIRRDYF
MMDIIMNYNKTIITHDENKVLQNPDQQRRLFDNIIENLSTIIKQEFTSPNYFVSSGQLYI
ENQGKPIYEVFSDTSGDGIESPYLAQVKLINTIDQTKLNARFFVQELHQHDTFYSIKHWF
DMQRTLREDVKFHAVQRVLKQWRFFHDLANFLYPEVLDSVLLMCVKNKESLDDCLGASIV
SISWEF