Identifiers and Description

Gene Model Identifier

Contig18218.0.g6

Standard Name

DSRBD1

Aliases

Contig18218_0_g6

Description

Double-stranded RNA binding motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18218.0.g6(coding)
ATGAGTTAAATTAGTGAACCTCACCTTACTGCCCCAAAACCAAAGCCCAACCCATTATTG
CAGCCAAACATCATGCTTCCTCCTGGATGGATTCATTTCGATATTTATCAAAACTAGAGA
GTGTACTACAACTATCACTCAAAGTAGTTTAGTTTTTCTCCTATCTTTAATACTGTAGAC
TTCTTGTACACTTTTTAGAAACCAACCCTCCCGCCTATATCACTTGAAGACTTGAACTCC
AAGCTATCATTGATTGAAGAAGATATTAAGCAAAGAAATAACGGAGAGCTTCCCTAGCCT
CCACGCTCATTGTCAGATCAAATTGAAGAGCTTATCAAAATCTATTCTTAGAGAGGTTCT
CAGATCAAGAAGACTCAAGCAAACTTAGATACTGCCAACCAATCACAGAGTATGGCTGTA
TAACAAAATCAAATGAGTTTACCTGACTAGAACTTGACTGAAATGCAGAAGAATGAGAGA
CTTTTTAAGCAAGCTTTAAAAAAGTATGTTACTGACAAGAAACTCAATCAGATTAAAGGA
TGCACAAGGACTACTGAGTAGATTAGCTTGCTAATGCAAATTTGCTAGCAAATCTTTCAA
TTGAGCCCATCTTTTCAGTACAAGGATATTAATGAAGGTAGAGAGAAGTTCCTTTGCATG
ATTGACTTCTAAGGTATTCCTATCAGCTCAGGAAAGGGCCACAACAAGAGTGAGTCCAAG
AAGACTGCCGCACAAAATGCTTTGAAAGTTATTGCTCCCAAGGTTTACAAGGAAGTCTTT
GGCGAGGATCCCACTCCTTCATCTAACTCCCCTCTGCCAAAATCTTAATCACTTTAAAAT
ATTAGTCCAAATGCTTCTCAAGCTCAGAATTAAGTGTAGCATCTACCAACAGCTTAACCC
ACTACAGTTTCGCCTTCTCAAAAGCAGCAAAAATCTAACAAGAGTTTGACTTCCCTTTTG
TCTCAGAGTTAAGTGAATACTGGAAGTTAAAGCTAAACTTCTAAGGCTCAACCACTTTTT
GTGAGTTAAAGACTTGCTTAAAATGTCGGTGACTAATCACATGATGATCAGAGATCTAAA
TCAAGAACAAAAATAGTTATGAGAAAGAACCTTCAAGAAGAAGTGAAGTTGCCAGATTAA
GTTATGAACCTAAATTATTAAGAATTTGATATACTTCCCACTGATGAAAATCTTCAAGAG
ATTACTTTGAGTCACTCTAATTTTCTTAAAATAGGCCATTTGTTTACCACTTATACCCCT
TATACTATTTTGAAAATATACTCCCAGAAGAACAACCTGAGCTTTGATGAGCATTTGTAG
AACTAGAAATCACGTGATCCAAACAAGGTTCTCAGCTTTGAAATAAGACTTTCTGATATC
ACTTCTCGCTAATAACGCTATTGTCACATGGCATATGGTCCAAACAGAGAGCAAGCTAGG
ATCAAAGCTGCCTTGCATATACTTCAATAGATATTTACCCCACACAAGAGATGGCTTGAG
CTAGTCAAGGAGATTCAGGATTAGGTTTACAACGATCGCATCCGAAGAGGCGTTGGAGAG
AAGCCCACCCTCTAGAAGTATGACAAGGAGACTAACAAGTTTACTAAGGACTGGAAGCAG
AAACTCCAAGTCAACTCTCAGCACTAAGCTGATGCCGACATCGATGACTATGGTGAAGAA
TCAGATCAGGAAATGGATGGAGAAGACGATAGTGAGGATGAATAGGAGAGTGATGATGAT
ACTCCTCACCAAATGCAATAGAAAACTGTTCTCCAGAAGAAGCAAACAGCAAAGTCTAGC
TTGATCAGAACAAACAAACCCTAAAAGGATCCCTAAGATGCTAGTGGTAATCCTGCTGGA
AAAGCTTCAGATTTTGGTGAAACTGAATGCATCGAAATTGATTGA


>Contig18218.0.g6(protein)
MSQISEPHLTAPKPKPNPLLQPNIMLPPGWIHFDIYQNQRVYYNYHSKQFSFSPIFNTVD
FLYTFQKPTLPPISLEDLNSKLSLIEEDIKQRNNGELPQPPRSLSDQIEELIKIYSQRGS
QIKKTQANLDTANQSQSMAVQQNQMSLPDQNLTEMQKNERLFKQALKKYVTDKKLNQIKG
CTRTTEQISLLMQICQQIFQLSPSFQYKDINEGREKFLCMIDFQGIPISSGKGHNKSESK
KTAAQNALKVIAPKVYKEVFGEDPTPSSNSPLPKSQSLQNISPNASQAQNQVQHLPTAQP
TTVSPSQKQQKSNKSLTSLLSQSQVNTGSQSQTSKAQPLFVSQRLAQNVGDQSHDDQRSK
SRTKIVMRKNLQEEVKLPDQVMNLNYQEFDILPTDENLQEITLSHSNFLKIGHLFTTYTP
YTILKIYSQKNNLSFDEHLQNQKSRDPNKVLSFEIRLSDITSRQQRYCHMAYGPNREQAR
IKAALHILQQIFTPHKRWLELVKEIQDQVYNDRIRRGVGEKPTLQKYDKETNKFTKDWKQ
KLQVNSQHQADADIDDYGEESDQEMDGEDDSEDEQESDDDTPHQMQQKTVLQKKQTAKSS
LIRTNKPQKDPQDASGNPAGKASDFGETECIEID