Identifiers and Description

Gene Model Identifier

Contig16930.0.g77

Standard Name

DRN1

Aliases

Contig16930_0_g77

Description

Protein similar to CwfJ C-terminus 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam04677 ) Protein similar to CwfJ C-terminus 1
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam04676 ) Protein similar to CwfJ C-terminus 2
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam01230 ) HIT domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005767402.0009381340492598e-66Cwf19l1 protein
SGDYGR093W0.000000000000020000882446601127YGR093W SGDID:S000003325, Chr
VII from 670388-671911, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16930.0.g77(coding)
ATGATCCTTAAATTATTTATCTATAGAATCGTAGTAGGAAACGTCAATGGTGAAGTAAAA
AAGCTTTACTCTTTAATTGATTAAATTCAATCGAAAAAGGGGAAATTTGACTTATTAATT
TGTGTAGGAAAGTTCTTCGCTCCTAATTAATAGGACTTGGAAGAATTCTATCAAGAAATA
ATGAACCCAAAGACTAATTTGAAAATTCCAATACCTACATATTTCATAGATTCAACTTAA
TATGTGAGTCCCTTAATGAATGCTACAAAATCTCAAAATGGTTATGAAATTGCAAGAAAT
TTGAAATTTATGGGGAGAGCAGGTGTGCAATTAATAAATGGACTTAGAATAGCTTTTATT
AGTGGAATTGACATAGATTCTATTACCACTGTAGATAAAGAAAACGATCAGGAATTCTTA
GGTTCCTATTTTAAGCATTCAGATTTAGTGAAAGTTTAAGAGGATTATGAAAATATCTTA
AAAAATGAAAAGAGTGGGAGGAGAGGTATTGACATTTTTATTTCTAGTTAGTGGCCATTA
GATATTGCTGATCACGCTTATTTCAATTCATTGAGTTTGTAAGAGTAGAAATAGCTGTTT
TACAATAGTTCTTCTTCAGTAGTTGCGCTTCTGAATTTATTATCTCCTCGATATGTCTAC
TCATCTAATCTTGATGTTCATTATAAAAGACTGCCTTACTTAAATCAAGATAGTTTCCTG
ACAAGATTCATATCTCTGGGGTCAATCCCAGGCAAGCACAAACCCCAAGACAGCAAATAA
GTCTATATTCAAGCAATTGAAATCGAGGGAATCCAAAGGATATAGGCTTAAGATTTATAT
GGAACTCATTAAGTAATGGAGCTCAACAAAGACTATACTGTAAACCCTTATATTTCTGGT
GAGATTTTTGAAAAAGTTAAAAGTCCCCTGCAAACTGAAATTTGTTCGTTTGATCTCGAG
AGCATGTTGAAAATTGCATATGATAGAAAGTTGTAAATTGGAGAGGAATTATTATCTAGA
GAAGAGGCTGAAGAACGAGAAAGAGCTTAGAAGAGATATGAACAATCGCATCATGAAAAA
CTGAATCAAATTAAAGAATAAATTGGCGAGTACTAACAAGAAGAGAGAACTATCTATGTG
GGAGGATTTGATAGACACTTGGCTATTGAGGATCTACAAAACTTTTTAACTAAATATGGT
AAAATCAAGAATTTACAGAGATAGTTTGATCAGAAAGGTCACAGTAAGGGCTACGTATTC
GTGGAATACGAGACCAAAGAAAGCGCTGAGGCAGCTGTGAATGAAAGTGGGCGTGCAAAT
ATTCTGGGAAGAAAACTCATTATGAATCATAAGATGAGCAAGGTAAAAGTAGTTGAAGAC
AAAGATTGTTGGTTCTGCTTCGATAACCCTAATATTGAGAAGCATATGATATTCGATATA
AGAGATCAATTTTATGCTGCTCTTCCTAAAGGTCCAGTGACAGATGAACATATACTGATA
ATACCCAAAAAGCATATTGGCCACTCTTTAGAACTTGATAATGCTCAAGAAGAAGAGTAC
CTGCAAATGAAATAAGACTTACTAGAACTAGTCAGCAAAAAGAATGGCTTAGACTATATC
CTATTCGAAAGAAATGTGCCTTTTAAATTTCAAAAAGCTTTACACATGAACCTGCAAATC
ATAGCACTCCCCTCAGACTCATCGCTTGAGATGCGAGTTCGTAAACTTCTAAAAGTCTTT
GAACAGCAGCAAAACGTAAAATTCATTGAGATAGAAGATAAAGAAATGGACTTGAGAGGA
GCCCTGAAAAATGATCCCACTCAGCATTTCTTCTACTTGGAGATACCAGGCATGAAAACA
GCAAGAGGAAGACAGAAAATCAGATTTTATTGTGTGATTGAGGAGGGGAAAACTAGGTTT
GATCTCTAATTTGGTAGAGTACTCGCTTGCCATTTACTCAATGCTAGAGAAAAGCTGAAT
TGGAAAAACTGCGTATTAGATAAAGACGCAGAAGAATAATTAGCTAATAAATTTAAGAAA
GAACTGCAAGATTTAATTAAAAATAGAAAGCAATAATGA


>Contig16930.0.g77(protein)
MILKLFIYRIVVGNVNGEVKKLYSLIDQIQSKKGKFDLLICVGKFFAPNQQDLEEFYQEI
MNPKTNLKIPIPTYFIDSTQYVSPLMNATKSQNGYEIARNLKFMGRAGVQLINGLRIAFI
SGIDIDSITTVDKENDQEFLGSYFKHSDLVKVQEDYENILKNEKSGRRGIDIFISSQWPL
DIADHAYFNSLSLQEQKQLFYNSSSSVVALLNLLSPRYVYSSNLDVHYKRLPYLNQDSFL
TRFISLGSIPGKHKPQDSKQVYIQAIEIEGIQRIQAQDLYGTHQVMELNKDYTVNPYISG
EIFEKVKSPLQTEICSFDLESMLKIAYDRKLQIGEELLSREEAEERERAQKRYEQSHHEK
LNQIKEQIGEYQQEERTIYVGGFDRHLAIEDLQNFLTKYGKIKNLQRQFDQKGHSKGYVF
VEYETKESAEAAVNESGRANILGRKLIMNHKMSKVKVVEDKDCWFCFDNPNIEKHMIFDI
RDQFYAALPKGPVTDEHILIIPKKHIGHSLELDNAQEEEYLQMKQDLLELVSKKNGLDYI
LFERNVPFKFQKALHMNLQIIALPSDSSLEMRVRKLLKVFEQQQNVKFIEIEDKEMDLRG
ALKNDPTQHFFYLEIPGMKTARGRQKIRFYCVIEEGKTRFDLQFGRVLACHLLNAREKLN
WKNCVLDKDAEEQLANKFKKELQDLIKNRKQQ