Identifiers and Description

Gene Model Identifier

Contig22824.0.g63

Standard Name

DRH43

Aliases

Contig22824_0_g63

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam00176 ) SNF2 family N-terminal domain
  • ( pfam13401 ) AAA domain
  • ( pfam00543 ) Nitrogen regulatory protein P-II
  • ( pfam00004 ) ATPase family associated with various cellular activities (AAA)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004859803.999244945363787e-60Helicase conserved C-terminal
domain containi...
SGDYPL119C6.002144168983342e-19DBP1 SGDID:S000006040, Chr XVI
from 326264-324411, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22824.0.g63(coding)
ATGAGGAAGTTTAGCACAGTGACCAACAGATTAACATCAGAAAATTTGAAAGTAGCAAGG
AAAGCTAATTAATTATTTAAAGAAGAAAGAAGTGACACAAGCAAGTTCACTTATCTTGAT
TAATAGCCTGAATTTGCGGAAATTGAAGGGAAAATACATCCAGATCTATAAGAAGGCTTG
AAAATTAATAATTATCAGTACATGACTGAAATCTAGAGTTTGGCTATAAAAAACGGTCTC
TTTGAAGGTTAAAATATGATCCTTACCTCTGAGACAGGTTCTGGAAAGACCTTAGCATAC
CTACTTCCAATTATAAATTAACTCCTGCATTTCTAGGACAAGAAGGGTGTGCCAGAGAAA
GGCACTAGATTTAGAATGAACAAGGCCAATGAAGAACAAATGTTCCTCAGTGCAGGAGAA
ATAATGTACTAAAGTTAAAAATAAGGAGGAAGCGGCAATACAAAATCGAGATTGAGTTTC
GGCAGAAGCGGAGGAACTGGAGTTGATGATATGAAAGGAGCGCTTATACTCAGCTACTCC
AAAGAGTTACTTAATCAGATCTATGTCACTGCTAGATTTTTAGATGTTAAGGAAAGATTG
TAAATAAACAGAGCAACTTCAGCATTATAGATGAAGACACCTATTGTTGAATTCATTACC
CCAGATAAAGATAAGGGAGAGAAGGAATTGACAGAAGATGAGCAATTTGATATTTAACTT
AAAAATGTGATAAACAATGCAAGCTGGAGTATAACTGACATATTATTAGCAACACCAGTG
GTAATGAGTCATATTTTAGACAATAAGGAAAAATTCGATCCATACGACATAAATCCAGCT
GTAATAGTGATTGATGAATTTGACGAACTGCTTTCGAATTAATCAATTAATCCATAATTA
GTAAAGATATTGAGAAAATTTGCTACTTTTGATGGAAATAAAGATAGTCAGATGGCTGAT
TTAAACCGCAGAAGATAATTCATATTTACTGGAGCAACAATTCCAAGGACTATAATGAAT
GGCCATGATACATTAAATACTCTTTATGATTGGTTCCCAAATATCAAGCATATCAAGACT
GAAACACTCCACAGAGTATCATAATTAATAGAATACGAATGGATTGATCTTGAAAGATCT
CATGCAATAAGAGCATCTCAAGTATACTGCGAGGACCATGAAATAAACATTCTTGTTGAC
TAAGTTAAAAGATCAATTGATGTCCTTCGCAATAGAAGTATTATGATATTTGCAGAATCT
AAAAAGACCATAGATAAAGTTTGTGAAGCATTAAGAAAAGCAGAGATCAAGAATTTACCC
TATTATCACGATATTGGAGTTCAGGGTAGACAAACCACCCTCCATCATTTTTTCAATAGA
GAATTACCAGTTTTGGTTTGCTCAAACATGGCTTCAAGAGGCTTGGACACTATAAATGTA
GATCATGTAATTCAATTTGAATTTGCAAAAAACGCTATTGATTACATTCATCGTGTTGGT
CGTACTGGAAGACTCGGTCAGAGAGGGTATGTTACAAACTTCACAAGAAAAGGAGATAAT
GAGCTTGAATAGCAAATCAGGGAGCTGGACTAGAAAAAAGACTCTTATGAATCTTTAATT
AGAAAAAGCAAATCTTAATCAAGTACAAGCATTAAGAAGCCTTCATAAAAATGA


>Contig22824.0.g63(protein)
MRKFSTVTNRLTSENLKVARKANQLFKEERSDTSKFTYLDQQPEFAEIEGKIHPDLQEGL
KINNYQYMTEIQSLAIKNGLFEGQNMILTSETGSGKTLAYLLPIINQLLHFQDKKGVPEK
GTRFRMNKANEEQMFLSAGEIMYQSQKQGGSGNTKSRLSFGRSGGTGVDDMKGALILSYS
KELLNQIYVTARFLDVKERLQINRATSALQMKTPIVEFITPDKDKGEKELTEDEQFDIQL
KNVINNASWSITDILLATPVVMSHILDNKEKFDPYDINPAVIVIDEFDELLSNQSINPQL
VKILRKFATFDGNKDSQMADLNRRRQFIFTGATIPRTIMNGHDTLNTLYDWFPNIKHIKT
ETLHRVSQLIEYEWIDLERSHAIRASQVYCEDHEINILVDQVKRSIDVLRNRSIMIFAES
KKTIDKVCEALRKAEIKNLPYYHDIGVQGRQTTLHHFFNRELPVLVCSNMASRGLDTINV
DHVIQFEFAKNAIDYIHRVGRTGRLGQRGYVTNFTRKGDNELEQQIRELDQKKDSYESLI
RKSKSQSSTSIKKPSQK