Identifiers and Description

Gene Model Identifier

Contig17487.0.g99

Standard Name

DRH38

Aliases

Contig17487_0_g99

Description

Helicase associated domain (HA2)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004197309.997093137033517e-262hypothetical protein
SGDYER013W1.0001788721085356e-149PRP22 SGDID:S000000815, Chr V
from 178841-182278, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17487.0.g99(coding)
ATGGAAAGTTTACAAGATCATTAAGTTGAAAAAGGCAGTAATTTAATGAATGAAATTCAA
GCAGAAAGAAAAGAATTGCCCATATATGAGTTTAAAAATGAAATAGTTGATGTCATCAAG
AATAACTTGTTTTGTGTGATAACAGGTGAAACAGGTTCAGGTAAATCAACACAGATTGCT
CAATACATAATTGATAATATGACAATCAAGGATTTTAAATAGTATACCAACTAGGAAATA
TTTTCAATGCTAAGTGCACAAATCAATTTACCAGAACAATCCAACAATAAAAAATCCTCA
AATTAAATTTCTGGAATAGATAGAAATCATGATTCTACCTCATCTAATAAATTAGTAAAA
GTAGTTGTGACTTAGCCCAGAAGAGTAGCTGCAATTTAAATGGCTAAGAGAGTTTCATAT
GAAAGACAAACCAGTCTTGGGAGAGAAGTTGGTTACTCTATTAGATTCGATGATTGCACT
GATTCTAAAGGAAGAACGCAGATCAAATATGTCACTGATGGTATTTTGGTAAGAGAATGC
CTTTTAGACCCAGATCTCAATGAATACTCAGTAGTAGTATTGGATGAAGCTCATGAAAGA
AGTTTAAACACAGATATATTGTTTGCACTAGTAAAATAAGCAGTTCTTAGAAGAAGAGGC
TAGTTGAGATTAGTGGTAACTTCAGCCACTTTGAAAACAGACTAAATAGCTAAATATTAC
TTTGCCTTTGTCAAAGAAGAAAATAGTCAATTAATCGATCAAAATTAATCTTCATAATTA
AAGCAATAATAGCAGCAGTAATATTATGGGTGTCCAGTACTTTCAGTATCTGGAAGGTGT
TTCCCAGTAAGCATACTGCATTAAGATAGTCCGAAGGAATAAAGAGTTGAAACATCAGTT
TAAATAGCTATTCGTATACACCTTAATGAACCATCAGGAGACATATTAGTTTTCTTAACT
GGATTTGAAGAATGTGAACAAGCCACTAAAAAGTGTTTTGAAAAGTTAAGTAATATAGCT
GAAAGGAAACAAGTACCTCCTATGATGATAGTCCCATTGTATGGATCTTAAACTGCAGAA
TAACAAGCAAATGCCTTCTTAAAAACTCCAGAAAATTGCAGGAAAATAATCTTCGCCACT
AATATTGCTGAAACATCACTGACTGTTGCAAATATTGGGTATGTTATAGATTCTGGTTTT
GTTAAACAAAAGATTTACAACTCCTCAACTGGAATGGAATCTTTGTAAATAGTGCCAATT
AGTAAAGTTCAAGCAATCTAAAGAGCAGGTAGAGCTGGTCGTACAAGAGAGGGTAAGTGT
GTGAGACTATACACAGAAAAATTCTATAAAGAACAGATGCCTGATTCCACTGTACCTGAG
ATCAAGAGAGTCAATTTGACTGGAACAGTGCTAACTTTGAAGAGCATGGGCATTAATGAT
GTTATTGAGTTTGATTACTTGGACAGTCCTGATTTGGATACTATTGAACATGCGCTTAAG
ACTCTTTATTATCTTGAAGCTATAAATAAACATGGTGAACTTACAAATCTTGGTGAAGAA
TTATCTAAATTCCCATTGGAGCCCACATATACTAAATCTCTCTTTGCTTATCATTAACTA
GCCTATAATTACAGATCCCATGAAGACATGCTAAGTCTCGTGTCTCTACTATCAGCAGAA
AATATCTGGGTAGGTGTAAGCAGACATGATGAGGGGAAATTAGATCGACTGGAAGAAGTA
AAGCGTAAATTCAGTGATAAACAAAGTGATCACATGAGCTTGGTGAATGTCTTTGAAGAA
TGGCAGACACTCCCCAGACACAAGCAAGACGATTGGTGCTTCAAGAATTTCATCTAAGCC
AGAGCTTTAAAACAAGCAAAAAACATAAAAGAACAATTGATTGACTACTTATCCAAAGTT
AACTGGGAATCAATCAGAAAGTTACTACCGAAATCATAACAATAAAATGAAAAAGGCGAT
CGCAATAAATTGTCATATGAAGATAGATGCAGGCTTTTGCGAAAATCATTGTGCTAAGGC
TTCTATATGAACACTTCAAGGAGAGTACCTCATAATACCATAGAGGGCAGTTATTTAACA
GTCAATGAAGGATTAATGGTTAGGACAGATCGATAAAGCAACTTCTCACTTAATAAGCAT
TACCCTGATTGGGTAATTTACACAGATATAAGTTCTTCAGCTAATGGAAGTGCTGGCATG
ATGCGAATGGTTTCTGAAATTAAATTGAGTTGGGTAGAAGACAATCTTCCTAAACTTAAG
GAAATTGATGTTAAGTAATTGTGCGGTAGAGCAACTCAAAATTCTGATAATGGTAAAAGC
AATTTAGGTAAAAGGAGTGGCAAAGATGGTGATGAGTAAACTGATGATATTAATAAACAG
GAAAGTAAAGAAATGACTAAGGAAGAGAAATTGAGAGAGTTGCAGGATAGATTCAAGAAA
AGACAAAAGAAATGA


>Contig17487.0.g99(protein)
MESLQDHQVEKGSNLMNEIQAERKELPIYEFKNEIVDVIKNNLFCVITGETGSGKSTQIA
QYIIDNMTIKDFKQYTNQEIFSMLSAQINLPEQSNNKKSSNQISGIDRNHDSTSSNKLVK
VVVTQPRRVAAIQMAKRVSYERQTSLGREVGYSIRFDDCTDSKGRTQIKYVTDGILVREC
LLDPDLNEYSVVVLDEAHERSLNTDILFALVKQAVLRRRGQLRLVVTSATLKTDQIAKYY
FAFVKEENSQLIDQNQSSQLKQQQQQQYYGCPVLSVSGRCFPVSILHQDSPKEQRVETSV
QIAIRIHLNEPSGDILVFLTGFEECEQATKKCFEKLSNIAERKQVPPMMIVPLYGSQTAE
QQANAFLKTPENCRKIIFATNIAETSLTVANIGYVIDSGFVKQKIYNSSTGMESLQIVPI
SKVQAIQRAGRAGRTREGKCVRLYTEKFYKEQMPDSTVPEIKRVNLTGTVLTLKSMGIND
VIEFDYLDSPDLDTIEHALKTLYYLEAINKHGELTNLGEELSKFPLEPTYTKSLFAYHQL
AYNYRSHEDMLSLVSLLSAENIWVGVSRHDEGKLDRLEEVKRKFSDKQSDHMSLVNVFEE
WQTLPRHKQDDWCFKNFIQARALKQAKNIKEQLIDYLSKVNWESIRKLLPKSQQQNEKGD
RNKLSYEDRCRLLRKSLCQGFYMNTSRRVPHNTIEGSYLTVNEGLMVRTDRQSNFSLNKH
YPDWVIYTDISSSANGSAGMMRMVSEIKLSWVEDNLPKLKEIDVKQLCGRATQNSDNGKS
NLGKRSGKDGDEQTDDINKQESKEMTKEEKLRELQDRFKKRQKK