Identifiers and Description

Gene Model Identifier

Contig21926.0.g9

Standard Name

DRG2b

Aliases

Contig21926_0_g9

Description

50S ribosome-binding GTPase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003163603.0005817332825333e-174GTP1/OBG family protein
SGDYGR173W1.0004025422005049e-134RBG2 SGDID:S000003405, Chr VII
from 843854-844960, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21926.0.g9(coding)
ATGGGGTTGACTGACAAGATAAAGGAAATCGAAGAGGAGATGGCTCGTACTCAAAAGAAC
AAGGCCACTGAGTACCATTTGGGTCTACTCAAGGCCAAGTTGGCTAAGTACAGGTCAGAA
ATCATAGATGGAGAGAAGAGAGCAGCAGCAGGAAGTAAGGGAGAAGGTTTCGATGTAGAG
AAGCATGGTGATGCTCGTATTGCTATGATCGGATTCCCCTCTGTTGGTAAATCTTCAATT
CTCTCTCATCTCACAGAGACTGAGTCTGAGTGCGCTGCCTACGAGTTTACTACTCTTACT
TGCATTCCAGGTGTTCTTCAGATCAATAATGCTAATATCCAATTACTCGATCTACCAGGT
ATCATTGAAGGTGCTGCCAGTGGAAAGGGTAGAGGTAGACAAGTTATCGCAGTCGGCAAG
AGTAGTGACCTTATCATGATGGTCCTAGACGCTCAAAAGGGAGAAGAACAAAAAGCTAAG
ATCACAAGAGAATTAGAAAGTGTGGGCATCAGATTGAACAAGGAAAAGCCAAATATTAAC
ATTAAAGTAATGAAGACTGGTGGTATTATATTCAACGCCTCAGTTAAGCTAACTAAAATC
GACGAAAAGATGGTCCGTAATATTATGGCAGAATACAAAATGCACAACGCCCATGTTAAT
TTCAGAGACGATTACGATGTCGATGATTTGATTGATGTGATTGAAGGCAATCGTAAGTAC
GTTAAATGCTTGTATGTCTACAATAAAATCGACACTATCTCTATCGAGGATGTGGACAAG
CTTATGAGCATTGACTATAACGTAGCCATTTCTGTTCATTTCAACTTGGGTATTGATGTA
CTACTTGAGAGAATCTGGGACTTGTTGGCTTTGGTCAGAATCTACACTAAAAAGAAGGGT
AGTCAACCAGACTTCAGTGACCCGCTTATCTTAACTCAAGGAAGAGATGGTGTGACAGTG
AAATCAGCAATTATGCAAATTCATAGAAATCTGTTAAAGGAGCTAGCTTATGCCTATGTC
TGGGGTAAGAGTGCAAAATTCTCACCTTAAAAATGTGGTCTCAAGCATACGCTCAATGAC
GAAGATGTTATTCAGTTTATTAAGAAAGCTTCAGGGGCTAAGTGA


>Contig21926.0.g9(protein)
MGLTDKIKEIEEEMARTQKNKATEYHLGLLKAKLAKYRSEIIDGEKRAAAGSKGEGFDVE
KHGDARIAMIGFPSVGKSSILSHLTETESECAAYEFTTLTCIPGVLQINNANIQLLDLPG
IIEGAASGKGRGRQVIAVGKSSDLIMMVLDAQKGEEQKAKITRELESVGIRLNKEKPNIN
IKVMKTGGIIFNASVKLTKIDEKMVRNIMAEYKMHNAHVNFRDDYDVDDLIDVIEGNRKY
VKCLYVYNKIDTISIEDVDKLMSIDYNVAISVHFNLGIDVLLERIWDLLALVRIYTKKKG
SQPDFSDPLILTQGRDGVTVKSAIMQIHRNLLKELAYAYVWGKSAKFSPQKCGLKHTLND
EDVIQFIKKASGAK