Identifiers and Description

Gene Model Identifier

Contig6883.0.g74

Standard Name

DRG2a

Aliases

Contig6883_0_g74

Description

TGS domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011049207.002846707792393e-180GTP1/OBG family protein
SGDYAL036C1.000274544751666e-156RBG1 SGDID:S000000034, Chr I f
rom 76152-75043, Genome R...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6883.0.g74(coding)
ATGGCTAGAACCCAAAAGAACAAGGCAACTGAGGGACATTTGGGTCTTCTAAAGGCTAAA
ATGGCTAAGCTTAAGCGTGAACTCATCGAGGGTGGCTCTAAAGCAGGTGGTGGTGGAGAA
GGTTTCGACGTCTCCAAAACTGGTGATGCTAGAGTAGGATTGATTGGATTCCCTTCAGTT
GGAAAGTCAACCCTTCTAACAAAACTTACTGGACAGTTCTCTGAAGCTGCCGACTACGAG
TTCACAACCTTGACATGTATTCCAGGTGTTTATAAGTATAAGGGATCTAAGATTCAACTT
TTGGATCTTCCAGGTATCATCGAAGGAGCCAAGGATGGTAAAGGTAGAGGTAAATAGGTT
ATCGGAGTAGCACGTACTTGCTCACTCATTCTCATTGTTCTTGACGCTATGAAGCCACTT
ACCCACAAGAGAATCATTGAGCGTGAGCTTGAAGGTTTCGGTATCAGACTTAACAAGAGA
CCACCCAATATTGTAATCAAGAGAAAGGAAAAGGGAGGTTTGAATGTTATGAAGGCCCAA
AATGTTGAGTTAACTAAAGTCTCTGAAGATACAGTAAAGGCCATCTGTCACGAATATCGT
ATTTCAAATGCTGATGTTTACTTCAAGGCTGATCACTCAGTAGATGACTTAATTGATGTT
ATCGAAGGAAACAGAGTGTACACTCCATGCATCTATGTCATTAACAAGATCGATTCAATT
TCAATTGAAGAGCTTGAACTTCTCGATTAAGTGCCTCATTACGTCCCAGTCTCTGCCAAG
GATGAGTGGAACTTCGATGAGCTTATGGAGAAAATATGGGATTATCTTGATTTGATTAGA
ATCTACACAAAGCCCAAGGGCCAAATTCCTGATTACGAAGCCCCAGTCATTGTGCCACGC
AAGTTCTCTACTGTAGAAGGTTTCTGTAACAGACTTCACAAGGCTCTAGTTAAGGAGATG
AAATATGCAATTGTTTGGGGAACCTCAGCCAAGCATATGCCACAAAAAGTCGGTAAAGAT
CATCAACTCAATGACGAAGATGTTGTGCAGATTGTCAAAAAGATGTGA


>Contig6883.0.g74(protein)
MARTQKNKATEGHLGLLKAKMAKLKRELIEGGSKAGGGGEGFDVSKTGDARVGLIGFPSV
GKSTLLTKLTGQFSEAADYEFTTLTCIPGVYKYKGSKIQLLDLPGIIEGAKDGKGRGKQV
IGVARTCSLILIVLDAMKPLTHKRIIERELEGFGIRLNKRPPNIVIKRKEKGGLNVMKAQ
NVELTKVSEDTVKAICHEYRISNADVYFKADHSVDDLIDVIEGNRVYTPCIYVINKIDSI
SIEELELLDQVPHYVPVSAKDEWNFDELMEKIWDYLDLIRIYTKPKGQIPDYEAPVIVPR
KFSTVEGFCNRLHKALVKEMKYAIVWGTSAKHMPQKVGKDHQLNDEDVVQIVKKM