Identifiers and Description

Gene Model Identifier

Contig3922.0.g37

Standard Name

DPY30b

Aliases

Contig3922_0_g37

Description

Dpy-30 motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • cAMP-dependent protein kinase regulator activity (IEA) | GO:0008603

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001583900.00000000009998509410508463Dpy-30 motif family protein
SGDYDR469W0.0002999184360822198SDC1 SGDID:S000002877, Chr IV
from 1399015-1399542, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3922.0.g37(coding)
ATGAATCCTCTCGCTAACCATGATGTTAACTAATTGCCCATCAGAGCCTATCTTGAATCT
AATTTGATGCCTTTGTTGCTTGAAGCTCTTAATGAACTCGCTAAGCATAAACCACAGGAT
CCTATTGAATTTATTGCTAATTACATGCTTGAACACAACCCAGAAAACAGATGA


>Contig3922.0.g37(protein)
MNPLANHDVNQLPIRAYLESNLMPLLLEALNELAKHKPQDPIEFIANYMLEHNPENR