Identifiers and Description

Gene Model Identifier

Contig11768.0.g72

Standard Name

DPTB

Aliases

Contig11768_0_g72

Description

DNA polymerase type B, organellar and viral

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03175 ) DNA polymerase type B, organellar and viral

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11768.0.g72(coding)
ATGAATAGAGACCTTGCTTAAAAGCCAACTAAAAAATATACTACCAAATTATAAGAGAAA
ATGAAAAAGAATAAGAAATAGACTAAATCTTAACAAAAAGTGCTTACTGAAGCAACTAAT
TCCGACTTTAAAGTACGGATTTAATCTCCTACCCTGTCTATTAAAAATGAATCTACTAAA
GAATCTAGCAATTACGATGAAAATATTTCTCAAAATGAATAACTTCACTTCTTGAGTTCG
AGGCGGAAATTAAAAAGGCTTTTTAAAATGGAGAGTGAAGAAGACCTCGACGCCGCAGTA
TTTCTATTTCGCATTCGACGCAGAATGGATTCCAAACACATGGTTTAGACATCAACTGCC
CTCTCAGTCTCTCAGTGTGTCTCTACTTCCCTTAATTATTAAATTACTGACCATACTTAA
AAAACTATCTAATTGGCAGAATAATTTGAGTAGTCAATCTAATAAGAAAATTTATAAATA
TGTACTGATGGGTCTAAAGAGTATCCTGAGTCGGAACTTATTACATTACCAAATATTTCA
ACTAGTCTCCCAGCAATCAATGAATTCCAATAAATTGTTCTATAGCTCCCTAAAATTGGA
GAATGTTAGGATTTAAGAAATGCTCTGGAATTTTAAGAAATATTAAATCCACTATTTTCC
AGTCAACCTGTACTTGTGTTACCAGATAATTAATAATAAGGTCCCTTTTCTCATATTAAT
CTACCATTGTACCATCAGAAAGTAATATGA


>Contig11768.0.g72(protein)
MNRDLAQKPTKKYTTKLQEKMKKNKKQTKSQQKVLTEATNSDFKVRIQSPTLSIKNESTK
ESSNYDENISQNEQLHFLSSRRKLKRLFKMESEEDLDAAVFLFRIRRRMDSKHMVQTSTA
LSVSQCVSTSLNYQITDHTQKTIQLAEQFEQSIQQENLQICTDGSKEYPESELITLPNIS
TSLPAINEFQQIVLQLPKIGECQDLRNALEFQEILNPLFSSQPVLVLPDNQQQGPFSHIN
LPLYHQKVI