Identifiers and Description

Gene Model Identifier

Contig8290.0.g58

Standard Name

DPS1b

Aliases

Contig8290_0_g58

Description

tRNA synthetases class II (D, K and N)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00152 ) tRNA synthetases class II (D, K and N)
  • ( pfam01336 ) OB-fold nucleic acid binding domain
  • ( pfam01409 ) tRNA synthetases class II core domain (F)
  • ( pfam02115 ) RHO protein GDP dissociation inhibitor

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006160509.997093137033517e-262aspartyl-tRNA synthetase famil
y protein
SGDYLL018C4.001282277195165e-160DPS1 SGDID:S000003941, Chr XII
from 111575-109902, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8290.0.g58(coding)
ATGGAAGCCAATAAAGAATAGGACCCCGTCCCAACTCAACAAGAAGAGCAAAAGACCGAG
CAAGCCCAACCAAAGCAAAACACCAAGCACGATAAAGAGAAGAAGAAACAAGAGAGATTA
GCTGCAAGACAGAAGAAGACTGTTGAAGAAGAGTATAAGAAAGATCCTAATGATCCATCT
GCTGCCTTATTCGGAGAACTAGAACTTAACAGATCTCAATCAGACCCTGAGCTTAGATAC
GCCAGAACTTTCACATCAGTAAAAGAGTTAACTGAAGCTCACAATGGTCAAGAAGTTCTC
GTTAGAGCCAGACTTCACGCAACTCGTGGAACTGGAAAGATGTGCTTCCTCGTTGTGAGA
GAGCAATTCGCCACTGTTCAAGCAGTTCTTTCAGTCAATGACCAAATCAGCAAGGGTATG
GTCACATTCACCTCAAAGATCCCTAAGGAGTCAATTATCGATATCAAGGCCACCGTTACC
ATCCCAGAGAAGCCAGTTCAAACATGCTCACAAAAGGTTGAATTGCAAATCAAAGAAATT
TGGGTTGTTAACAAGTCAGTTCCCATGCTTCCATTCCAACTTGATGATGCCAGTAGAAAG
GTTGAAAATCAAGAAGATGAGGAGAAGCAACAACACGCAGAGGAGTCAAAGGATGGCAAA
CTTGCAGTCGTTGGTCAAGATGTTAGACTTAACAATAGAATTATCGATTTGAGAGTTCCA
GCTAACCAAGCTTTGATGAGACTTCAATCAGCTGTTGGTATGCTATTCCGTGAATTTTTG
TACACAAAAGATTTTATCGAAATCCATTCACCAAAACTCATTGGAGGTACCTCTGAAGGT
GGTGCTAATGTATTCAGATTGAACTACTTCGACCAAGAAGCCTGTTTAGCTCAATCCCCT
CAACTTTACAAGCAGATGGTTCTGTGCGGAGATATGCAAAGAGTATTCGAAATTGGTCCA
GTTTTCAGAGCTGAAGACTCAAACACTAACAGACATTTGTGCGAGTTCACAGGTCTCGAT
ATTGAAATGGTATTCAAGGAGCACTATTTCGAAATTCTCGATCTCTTAGCTGACTTGTTC
GTTCACATCTTCCAAGGATTAGAGGAGAGATTCGGCAAAGAACTCCAATCTGTTAAAGAC
CAATATCACTTCGAGCCATTCAAGTGCAAGTTACCAGTTGTCAGACTTAACTTCAAAGAA
GCTGTTAAGATGCTTGACGCTGCAGGTTACACTCAAGAGCCACTTCAAGACTTATCTACC
TTGAATGAGCAACAACTTGGTCGTCTTGTAAGAGAGCAATATGATACCGATTTCTACATG
CTTTACGGATATCCAACCAACGCTCGTCCATTCTACACCATGTTGGACCCCCACGACCCC
AACTATACCAACTCTTACGATTTCTTCATGAGAGGTGAAGAAATTACCTCAGGAGCTCAA
AGAATTCACGAATCTGAATTCTTGGCTGAGAGAGCTACAGCTCACAACATTCCAGTTGCC
ACCATTCAAGATTATATTGATTCATTTAAATATGGTGCCCCACCCCATGGTGGTTGCGGT
ATCGGTCTAGAGAGAGTCGTCAAGCTTTACTGTGGTATCAGAAACATCAGAAAGTGCTCA
TTGTTCCCAAGAGACCCAAAGAGACTTAAACCATGA


>Contig8290.0.g58(protein)
MEANKEQDPVPTQQEEQKTEQAQPKQNTKHDKEKKKQERLAARQKKTVEEEYKKDPNDPS
AALFGELELNRSQSDPELRYARTFTSVKELTEAHNGQEVLVRARLHATRGTGKMCFLVVR
EQFATVQAVLSVNDQISKGMVTFTSKIPKESIIDIKATVTIPEKPVQTCSQKVELQIKEI
WVVNKSVPMLPFQLDDASRKVENQEDEEKQQHAEESKDGKLAVVGQDVRLNNRIIDLRVP
ANQALMRLQSAVGMLFREFLYTKDFIEIHSPKLIGGTSEGGANVFRLNYFDQEACLAQSP
QLYKQMVLCGDMQRVFEIGPVFRAEDSNTNRHLCEFTGLDIEMVFKEHYFEILDLLADLF
VHIFQGLEERFGKELQSVKDQYHFEPFKCKLPVVRLNFKEAVKMLDAAGYTQEPLQDLST
LNEQQLGRLVREQYDTDFYMLYGYPTNARPFYTMLDPHDPNYTNSYDFFMRGEEITSGAQ
RIHESEFLAERATAHNIPVATIQDYIDSFKYGAPPHGGCGIGLERVVKLYCGIRNIRKCS
LFPRDPKRLKP