Identifiers and Description

Gene Model Identifier

Contig4385.0.g54

Standard Name

DPS1

Aliases

Contig4385_0_g54

Description

DNA polymerase III psi subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03603 ) DNA polymerase III psi subunit
  • ( pfam08963 ) Protein of unknown function (DUF1878)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4385.0.g54(coding)
ATGAAGAGATGCACTTTAATTAAAATTAAAATTAAATAGCTGCTCAAAAATATTGACAAT
GATAAAAGCGACTATGTACTATTGCAATTGTTTAATGATATATTGAAATTGCATAATGTT
GAGCTCCGAGAATCAGACAAAAACAGATTGAAGCAGAAGTATGTAAAGAGCATAAGCGGC
CAAGATAAAATCCTCTATAAAGAAGCAATTGCAGCTTTACACATCGATTTATCTCAAGTG
AATTCCCTATAGTAAAACAGTGGTTTTAAACCCTAATGGATCTTGAGGAATATCAACCAA
AATGACTTGAGAAATCAATCTACAGATGAAGCAAAGTCAATCTAGAGATTTATTAATAGC
GAGTATTCACCTAGTATAGCTAACCAACTAGACAATTTGAGTTTGTTTTCAGGCTTTAGT
GGTCTTAGGAGCGTTAAATTGAGTGAGAGAATGAAAGGTAGTGCGGAATAGAAATCCTAA
AATGATGGAATGGAAATTGAAGTTCTAAATCCTGAATTGCATTCGATTAAAAAGATTATA
CCAGGAAAGCTATAAACTCCCAGCCATTTATCTAACATGAAATCTATATCATTAGAAAAT
AGCTCTAAAGGGTTTCAAAATGGATACCTCAAAGTAGGAGATTATTCTACTGTACAAAAT
AAGAATTAATAAATTATGATTTTCAATTAGAAAATCAGCTATCTATATGAAAATGATCCT
AATAGATATTAAAAAATCACAGATCTGAATAAGCTGTTCTTGAATAAAGAGATATCAATT
GATGAATTTAAGATCATGCTGTCTTTCTCTTTAAATTTACCACAATCAAAGTCTTAAATC
ATAGATGATTTGGTAGAAGCAATTCATCTTATTAACCAAGAAACACTTACTGTCCAGCCT
TTCTTTACGAAATAATTAATAGATGACTTTTTCAATCTATGTCATTACTGGCCACTGTAG
ATTAAGAGAGACTCTAATCAGTCCTCTAATATGTACAAAGTGCTAAATTCATCGAAAGCC
AAAGATTTCAATACTTCTCTAGATTTTCATAAGACTCATAACTCGATAATAAAGAGCGAT
ATATTCAAGCTTTATGAAATGATTTGGAGTAAGATATGCGAAAAGTTTGACAAGATAAAC
TTAGCTTACAAGTTTTTCATTGGTGTAACAACAAACAAAATTGCATTCAATGACTTTGTG
AATTGGCTTAGAAAATTTGAGACTCAAGCTCACAACAAGAGAGATAAATGA


>Contig4385.0.g54(protein)
MKRCTLIKIKIKQLLKNIDNDKSDYVLLQLFNDILKLHNVELRESDKNRLKQKYVKSISG
QDKILYKEAIAALHIDLSQVNSLQQNSGFKPQWILRNINQNDLRNQSTDEAKSIQRFINS
EYSPSIANQLDNLSLFSGFSGLRSVKLSERMKGSAEQKSQNDGMEIEVLNPELHSIKKII
PGKLQTPSHLSNMKSISLENSSKGFQNGYLKVGDYSTVQNKNQQIMIFNQKISYLYENDP
NRYQKITDLNKLFLNKEISIDEFKIMLSFSLNLPQSKSQIIDDLVEAIHLINQETLTVQP
FFTKQLIDDFFNLCHYWPLQIKRDSNQSSNMYKVLNSSKAKDFNTSLDFHKTHNSIIKSD
IFKLYEMIWSKICEKFDKINLAYKFFIGVTTNKIAFNDFVNWLRKFETQAHNKRDK