Identifiers and Description

Gene Model Identifier

Contig4184.0.0.g11

Standard Name

DPE2

Aliases

Contig4184_0_0_g11

Description

DNA polymerases epsilon N terminal

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam12213 ) DNA polymerases epsilon N terminal

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4184.0.0.g11(coding)
ATGACTCAGTCTCAACAAAGATTGCAAAACTTGCCAAACGAGGCTTTCAAAATTTCTGGT
ATCTTTTTAAAAAAGAGCAATGTGACGATCATTTGCCCAATTGTAAACCATGTGAATTCA
GCAGTTTTTAGAAAAGATTCCTCAACAAGAAATAAAAAACAAATCATATACCAATGA


>Contig4184.0.0.g11(protein)
MTQSQQRLQNLPNEAFKISGIFLKKSNVTIICPIVNHVNSAVFRKDSSTRNKKQIIYQ