Identifiers and Description

Gene Model Identifier

Contig198.0.g16

Standard Name

DPCP1

Aliases

Contig198_0_g16

Description

DNA replication and checkpoint protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam11719 ) DNA replication and checkpoint protein
  • ( pfam14362 ) Domain of unknown function (DUF4407)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig198.0.g16(coding)
ATGGCTGCAATCTTTGGACTCTTGATAAGTAATTTATTCAAGAAGAAAATCAACAAAACT
GAAATAGACGATGAAATGATGTTAAGTTAGACTTAAAGCAGATTATTCGAAACAACTGGA
AAACAAATTATCGAAACTGACTAACAAAATGAAGAAACATTAAAAGCTTATTCTTTTGAA
AAAGATTATTAGAAACCACTTGCCAGATAATATAAAAAAGCTGTTGAAACTTCAGATATA
GATTTAAAACCTACCTCAGGCTCAGATAACATCCACTCTACATATTGTAATACATCAAGG
CCAATAAGACAATTCTTAACAAATAAAACGATTAATAATATGAAAGAATCCTTGCAAAGT
TTAAAAAAGAGATAAAATGCTACAGATAGAAGGATTCAGCATGAGAATAAATTAAAGAAG
TAATATCTTTCCGAGAATGAATTCGCGATGAAAAATATAAGAAAAAATGGGAATATCTAA
ATAGAACCTAAAATTGAAGACTACTGA


>Contig198.0.g16(protein)
MAAIFGLLISNLFKKKINKTEIDDEMMLSQTQSRLFETTGKQIIETDQQNEETLKAYSFE
KDYQKPLARQYKKAVETSDIDLKPTSGSDNIHSTYCNTSRPIRQFLTNKTINNMKESLQS
LKKRQNATDRRIQHENKLKKQYLSENEFAMKNIRKNGNIQIEPKIEDY