Identifiers and Description

Gene Model Identifier

Contig2237.0.g95

Standard Name

DPA1

Aliases

Contig2237_0_g95

Description

DNA primase DnaG DnaB-binding

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam08278 ) DNA primase DnaG DnaB-binding
  • ( pfam08496 ) Peptidase family S49 N-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2237.0.g95(coding)
ATGGCTATGAATAGAGACAATGTAATTAAATCAAGGAATTCAGATAGACCAGCTAGTTAA
CTTAATGAAATCAGAAATCCTCTTAATTTCAAATACCAACCTGAAACGATTATTCAAGCA
CATTTAGCATATGAAGGACTGTATGAAAATGCTTGGTCAGCAATCTATGATAAAGAACTT
GACTTGAGGAAGGTTCCGTTTAGTGTACAGCATACAATTGAAACGATGACATTAGGATAT
AAAAATTCTCTACGTTAGCCAGACAAACCAATGAGTCTGCCCTGTTCAGATTCTTTTAAC
ATGGATAATAACGATGACGAAGATTTAAGAGAGCCAGTGCCCTGCCCCAGAGATTAATGG
GCCTGCACTTTAGTTCCTCACAACATCAGATATATTGAGGTTGATCCCTAAAAGCAATTA
ATATTTGATAAAGCTAATAGTAAATCAGGCACTTCAAGAAGCAGGCGATCTCCAAGCAAG
AAAATGTTTAATGGAGGGTTTAGTACTTTCACTGATTTTGCACCGAATGCTCTCAATAGC
ACTCCAAGATCTTTGGCATCCAGGACTAACACCAGACTTTAAATGCTTCAAACTTAAAGA
ATGAGCTAACCACCAAAGAGTATTCCTTTGAAACCATTTTAAGATGAAGAGAAGCCGAAC
GAAGAATTAGAAGTAGATTAATTTGTAGAAAAAATGAGAACTTCTAAACTTAAAGAGGAA
CTTAGACAATTAAGAATTCAGGAATAAAAGCTGAGAATTCAATCATAGTCAAGACAAAAT
AAAATGAGGAAGAATTAGTATAATAACGATTTATCAAGTTTTTCGAATTAACACAGCCCT
AATAATAAAAAAGAAGAGCAAATCTTTACTTTTACAACGGATTTCAAAGGAAAAAAGATT
GAGTATAATCTACTAAATATGGAAAAGTTGAAGCCAGTTTAAATTGGGACTAAATTGATA
AGGAATTAAAGTGACGAAGCTTTTCTTGAAAAAATGAAAAAGCTCAGAAGAGTGCAAACA
TCATTAAACATCATCCCAGCACGAAAAAAAGGTACTATATTCGATTAATACAAAGATTCA
GTATCAACTCTAATTAAGCAACGATATGAGAGTAACAACTATTCGAATAATCCTAATTAA
ATTGTAATGCTTAGCAATACAGACACAGAAAGGAAGTATATTAAACCTTAGCCACCTTCG
TAATTATTAGATCTTTAACATGGTGTGAAGTTAAGAGACAGATTTACAACAGTTGGCGGT
GGAGAATTTACAATGACTCTCAGAAATTAAATGAGTAGAGAGGAATATTTTGGAAGTGGA
AGATCACATCGAATCATACCTCCTTCGCTTCAAAGTGGCAACAGCAAGAAACGGCTAACT
GAAAATGTTAGATTTTCTGAGGAAGAGTAGGATGATTAGGTAAGAAGTGGTGTTACTTCG
GCAGGAGGCCAATCAGCTTCTACTCAACCATAAACTGCAAGAATGTTTCCTAGTGACAGA
AGGATGCATGAAACTTCTTTGTCTACCATATATGGTGATTCAAATGAAGTAAGTATAAGG
AAGAAATTGAGAGGTCTTTAAGGCACAGGATCAATCAAAATGTCTAAAAGAAAAGATTAA
GTCAGGGATCTACTGAGCTACGACAAAAATAACCTTTGGAATGCAAATAAATTGAGCATA
GTTCTAAATCCATTAAATTCAGAATAGATCTAAAATTACCTTGGAGTTAATCCAAAACTA
AATTTCCAAACTATTCAATCAGCAAAAAATACACCTTCTACTTAATTAGCTTATGGACTT
GAACCAATTCAGTAAAACAATATTCAGACTCCTCGCTAAACATAGTCGAAAGATAAAATA
ATCTCGGAACCATATATGATATAAGCAAGGTAAGACCAGATTGAAAAGTTAAGAACATAA
ATTTTAACGAGATAAACTACTACACTTGCCCTAAGACCAAGAAACCAGTAAGGCTTCGAG
AAAAGTCAAACCTAGAAAATTCTTAGTAGCTTAGGGAAGATAAAAGAAAGCAGAAATAAT
ATAAAGCACTTAATTACTGATAAGTATACTGATAAAGATTGA


>Contig2237.0.g95(protein)
MAMNRDNVIKSRNSDRPASQLNEIRNPLNFKYQPETIIQAHLAYEGLYENAWSAIYDKEL
DLRKVPFSVQHTIETMTLGYKNSLRQPDKPMSLPCSDSFNMDNNDDEDLREPVPCPRDQW
ACTLVPHNIRYIEVDPQKQLIFDKANSKSGTSRSRRSPSKKMFNGGFSTFTDFAPNALNS
TPRSLASRTNTRLQMLQTQRMSQPPKSIPLKPFQDEEKPNEELEVDQFVEKMRTSKLKEE
LRQLRIQEQKLRIQSQSRQNKMRKNQYNNDLSSFSNQHSPNNKKEEQIFTFTTDFKGKKI
EYNLLNMEKLKPVQIGTKLIRNQSDEAFLEKMKKLRRVQTSLNIIPARKKGTIFDQYKDS
VSTLIKQRYESNNYSNNPNQIVMLSNTDTERKYIKPQPPSQLLDLQHGVKLRDRFTTVGG
GEFTMTLRNQMSREEYFGSGRSHRIIPPSLQSGNSKKRLTENVRFSEEEQDDQVRSGVTS
AGGQSASTQPQTARMFPSDRRMHETSLSTIYGDSNEVSIRKKLRGLQGTGSIKMSKRKDQ
VRDLLSYDKNNLWNANKLSIVLNPLNSEQIQNYLGVNPKLNFQTIQSAKNTPSTQLAYGL
EPIQQNNIQTPRQTQSKDKIISEPYMIQARQDQIEKLRTQILTRQTTTLALRPRNQQGFE
KSQTQKILSSLGKIKESRNNIKHLITDKYTDKD