Identifiers and Description

Gene Model Identifier

Contig3110.0.g49

Standard Name

DP2b

Aliases

Contig3110_0_g49

Description

DNA polymerase II large subunit DP2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam03833 ) DNA polymerase II large subunit DP2
  • ( pfam12668 ) Protein of unknown function (DUF3791)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3110.0.g49(coding)
ATGATAAACATGACATATCAGATATCAAAGGAACATAATTTGGATGTGAAAGACATAACA
GAAGAAGGCAAAGCTTTCAAAGTACAACAATTAATAAACAAAAACTATGAATTGCTCACT
GATGAGATACTTGGTCGGAAGAAGCATTACGATAAGAGCTATTCATCCCCTCTAGATCCA
AATTACATAGTGTCAACAAACTCAAAACGGATTATGATTCTTGGGCCAATTGATGATAAT
AAACCAAGACAGCTTATTAAAAAGGAAGTCAGAAAGGATACAAAACGATGCATGAGAATT
GATGATATCCAAGGGGCATAGCCAAAGGAAAGCGATTTAATTCCTCAGGATAAGTTGCCT
TAAATACATCCAACTTATCAAGATGGAAAAGGTCTTTAAGCCAAACAGTTACTCAATTTA
AGATTGAATTATGGAAAGAGAAATAGAGAAAGCGATAATATGTCTATGACATTAGCTATA
GATGAAAATTAAAGAGAGAAGTCATATATAATATATGCTAAACAATCTGATAGGAAAAGA
TCAAACCCTATTATACATGAAGATTACTAACCAATAATACATCCTAGAAATCAGAGTTTG
AGATTAAAGGAAAGTTAATTGGATAATTCTATTTAAAGTCATTCTAAACGCCACACAAAT
CTGTTAAACCATGTTGCTGAAATTTCAGTAAACTCTAAGCCAAATAGTTTTCAGCTAGAC
AAAGAATCATTCAATTCTAAAATAATAGGGAAATTTGGAGGGCCCAGTTTTGCACCATCA
AGTAAAGATTACGGAAATTTCTTATCAAATTAGCAAATCGATTAGTTGATATAAAATGTG
AGATAAATAAGCACACAAGAGCTCTCAAGGTCTTAAGTTTACCAAAGACTAAAGAAATTT
TATGAGAATGACAAGTCAAGAAGCAGTAAGTAAGGCAGATAGGCTAAGATTGGTCAACTT
TCGCAAGATCAAAGAAGTTAATTAAAAGGAATACTTAAGAATATTAAGCAAGTCAACAAG
CAAATAAAAGTAGTCTCACCAAAGAAGAAATGA


>Contig3110.0.g49(protein)
MINMTYQISKEHNLDVKDITEEGKAFKVQQLINKNYELLTDEILGRKKHYDKSYSSPLDP
NYIVSTNSKRIMILGPIDDNKPRQLIKKEVRKDTKRCMRIDDIQGAQPKESDLIPQDKLP
QIHPTYQDGKGLQAKQLLNLRLNYGKRNRESDNMSMTLAIDENQREKSYIIYAKQSDRKR
SNPIIHEDYQPIIHPRNQSLRLKESQLDNSIQSHSKRHTNLLNHVAEISVNSKPNSFQLD
KESFNSKIIGKFGGPSFAPSSKDYGNFLSNQQIDQLIQNVRQISTQELSRSQVYQRLKKF
YENDKSRSSKQGRQAKIGQLSQDQRSQLKGILKNIKQVNKQIKVVSPKKK