Identifiers and Description

Gene Model Identifier

Contig11236.0.g23

Standard Name

DNTTIP2

Aliases

Contig11236_0_g23

Description

Fcf2 pre-rRNA processing

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004445900.00000000000004998767099442072hypothetical protein
SGDYLR051C0.00000006998394348458725FCF2 SGDID:S000004041, Chr XII
from 246977-246324, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11236.0.g23(coding)
ATGCAAGAATTTAACATTGACGAAGATTTATCAGAGGATGAAGAAGAAATTCAGCAATCT
AAGAAACCACAAGGACCAAGAACCTACAACAATTAAATTCCGGATTCACTTAAAAACATT
TTTAGTAATAAAGCAGGTTCCATCGAGGAAAAAGTTAAAGAGGCAAGTATTTTCAATAAA
ACTCGTGGACTTGACACAAAGACCGACTCCTCAAACATCTAAAATGACGCCATGTTAAAA
GCTGAAGCTCTATATAAAAAGCTCAATGTTTTCAATAAGATTCCAGTGAACGCTAAGCAA
ATCACACCATTAAATAATATCTAGCTTGAGAAAAAAGAGAGACTTAAATAGAGAGAAGCA
AGCGCAGGAAAATCATGGGGTCATATGGCAAAGCAAGAATTGACTGAGGAAGTTAAGGCA
GATTTGAGAGCCATTCAATTGAGAAATTTCATATTCCCAAACAGGTTCTACAAGTCCACT
GACCTTAAGAAACTGCCAAAATATTTCCAGATTGGTACTGTAATTCCTGATAAGAATGAG
CCTTAAAACATGAGACTGACAAAGAAAGAGCAAAAGGGCTCAATCGCTCAACAGTTTATG
AGAGAAGACAACGAGAAGATGTTCAGTAAAAAGAAGTACGAGAAGGTCAACGATAGACTT
AGAAGAATGGGAGAGAAGAAACGCAAGATGAAAATGAATAAAATTAGACATAAAGCTAAC
AATAGATTCAAGTCAAAGGAAGCTGGAAAGCCCAAGAAGTGA


>Contig11236.0.g23(protein)
MQEFNIDEDLSEDEEEIQQSKKPQGPRTYNNQIPDSLKNIFSNKAGSIEEKVKEASIFNK
TRGLDTKTDSSNIQNDAMLKAEALYKKLNVFNKIPVNAKQITPLNNIQLEKKERLKQREA
SAGKSWGHMAKQELTEEVKADLRAIQLRNFIFPNRFYKSTDLKKLPKYFQIGTVIPDKNE
PQNMRLTKKEQKGSIAQQFMREDNEKMFSKKKYEKVNDRLRRMGEKKRKMKMNKIRHKAN
NRFKSKEAGKPKK