Identifiers and Description

Gene Model Identifier

Contig18537.0.g58

Standard Name

DNJ22

Aliases

Contig18537_0_g58

Description

DnaJ domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00226 ) DnaJ domain
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam11608 ) Limkain b1
  • ( pfam12067 ) Sox C-terminal transactivation domain
  • ( pfam06210 ) Protein of unknown function (DUF1003)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002556300.0002999184360822198DnaJ domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18537.0.g58(coding)
ATGTCTCTAAAATGGCATCCAGACAGAAACAAAGCCCCAGAAGCCAGAGATAAATTTGAG
CAAATCAAAGCCGCTTCACTTATTTTACTGTCAGAGGCTGACCGCAAGAACTACGATCGA
TATTTGAAGGCAAAGCAAGAAGCTTAGGAGAGAATTGAGAGAGCAGGAGCTGATCGAAAG
AAAATAATAGATGAGCTTTTGTAGAGGGAGAAAGAATATCAAGATAGCTTGAGGAGGCAT
ATGAGCTAAAGTCGGGCTGAAAGTACAGCAAGCAGCGAATATATGGGGCCAGAGGATGAA
GGGTTCAGAAAGGCAGAGAGCGAGCTTGAACGACTAATAAGAGAGATTAAAATTCAAGAA
TTTGATGAAAGGAAAGAAGAGAAGCAGAAAAAACGCAAGGATCACATTTCACAGCACTAC
GACATGACCACTATAAAAATCAAAATGAAGCCTCAGTAATAAGTACTAGATTTTGCAATG
AATGAATAATTGATCCGAAATCTTCTGAAGTAGTATGGAACCATCGATGGAGTGTTAATT
GATAAGAATGGTCTAAAAGCTTTTGCTATGTTTAAATATAGAGATTCAGCTCATAAAGCA
ATGAGTGCAAAATCAGAGAATGAAGCATTACATGGTTATCATATCAAGCTTTATAGCACA
TCTAAAGCTATGGAGAGAGAAGAGAGAAAGAAAAAGAGACATTTGATTTAAGATCCAATT
GAAAAAATGAAAGCTAAAATACTCATTGATTAAGGCACATATTCGAATATTACTGGATAA
AAGTTGGGCAAGACCTTCTTATAGAAAAGTTTAGAGGAACTAGAAGAAGAAGTATTTTAG
AAAATAAGAGTAAGAAAGGAAAGAAGACTAAATTAACAATAAGTTGCTTAATGA


>Contig18537.0.g58(protein)
MSLKWHPDRNKAPEARDKFEQIKAASLILLSEADRKNYDRYLKAKQEAQERIERAGADRK
KIIDELLQREKEYQDSLRRHMSQSRAESTASSEYMGPEDEGFRKAESELERLIREIKIQE
FDERKEEKQKKRKDHISQHYDMTTIKIKMKPQQQVLDFAMNEQLIRNLLKQYGTIDGVLI
DKNGLKAFAMFKYRDSAHKAMSAKSENEALHGYHIKLYSTSKAMEREERKKKRHLIQDPI
EKMKAKILIDQGTYSNITGQKLGKTFLQKSLEELEEEVFQKIRVRKERRLNQQQVAQ