Identifiers and Description

Gene Model Identifier

Contig19437.0.g14

Standard Name

DNAJC21

Aliases

Contig19437_0_g14

Description

DnaJ domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004906701.999469658314961e-75DnaJ domain containing protein
SGDYNL227C2.000364041471746e-45JJJ1 SGDID:S000005171, Chr XIV
from 222431-220659, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19437.0.g14(coding)
ATGTCCAAACTTAAAACTTGTTACTATGAGGTACTGGGAGTTGACGAAACAGCAACTCAA
AAAGACATAGAAAGGGGGTATAAAAAGTCGGCTTTAAAATGGCATCCAGATAAAAACAAG
GAGGAGGACACAACAGAGAAATTTTAGGCAGTCAGTGAGGCATATACCGTACTCTCAGAC
CCTAATGAGCGAGCGTGGTACGATTCGCACAAAGAACAAATTCTCAGTGGCAAGGAACAT
GAAGAAATGAAGGAGGAAGATTTTGAGTATTTGACCAAGTCAGATCTCTGGCCATTCTTC
AATTAGAGTTGCTACAGTGGCTATGATAAAAAGAAGGAAAATAACTTTTACAAGGTGTAC
TAGGATTTATTCCGCAAACTCGACAAAGAAGAGGAGGATGAGGAAGAAGTGGGTTAGGAT
CATTATTAAGCCCCGTACTTTGGTGATCAGGATTCTTGTGCGGAGGAGGTTTTCAGATTT
TATGAGCATTGGGTGCACTTCTCAACCCTCAAATAGTTTACCTATGCAGATAAGTACAAC
CCAAACCACGCCCCTAATCGCCAAGTAAAGAGACTAATAGAGAAAGAAAACACCAAAGAG
CGCAGTAAAGAACGCAAGGAGTTCAACGATTTGGTCATATAGCTGGTAGAATACGTAAGA
AAGCGTGATGTGAGGTATTAGAAGTTTAAGATACAAGAGCAGAGAGAAAAGGAGGCCAAG
AGACAGCAAAAAGAAGAAGAACTCGCCAAGAAGAGAGCTGAAGACTAAGAACGCCTTCGC
AAGTATAGAGAGGACATAGCACTCTAATACGCGAAGGAAGAAGAAAAAGCTCTGGCAGAA
GGGAACTATGAAGAGGTGCTTGTACACGAATTCAATTGTGGAATTTGCAAGAAATTCTTC
AAAAACGAGAAATAAATGGAGAATCACTTGTAAAGCAAGAAACACAAAGATAACTATAAT
AAGTTCAAGAGTGAAGTCAATTTGGATGAGGAGACTGAGAAACTCATTTATGAAGAATAG
GAAAGACTTAAGTAGCTATAAGAAGAGGAAGAGAATGAGAAAAAAAGAAAAATCTTAGAG
GAATTAGAGAACTAAAAGAAAAAGAAGACTAGACCTAATAAACAGAACTAAAATGATGAT
GAGGAAAGTACTACTCCATAGAATGATGATGAAAACGATGAAGCTGACAAAAAGGTCAAT
GGTAACCAAGATGATAAAACTCTAAAACAAAAACAATAAGAAGAGACTCAAAAGCAAGAA
GAAGAGGAAGAACAATATGTGAGCAAGAATAAACTTAAAAAGAAGAGCAAGGAACAAGAC
AAGAAAGGCGCTAAGAAAGTAGCTGGTGGTCCTCAAACAATCAAACAGTAATTCTTGAAA
ATGCCCAAGGATGAGCAGGAAATACTCATATAGAAACTGGAGAAGATATCAGGCGGTGTC
AAAGATAAAGATCAGCAACCTGCTAAAGACACAAAAGGAGGAAAGAAAAAGAAGAAAGGC
AAGGAAAGTGATGACGAAGAAGAAGAAAAGTTCATCCAATAGTAGCAACAGAAAAAGCCA
TAAAAAGGTGGAAAGAATCAAAAAGAATAGCCACCTTAAGCTCAGCCTGAGATGATAAAA
ACTCAAAAACAAAAGGGTTAACCACAACCATCAAAGAAAAAGGAGCATCTAAATACAAAA
GAAAAATAAGCTGATGATTAATAGGATAACGAAGAAGAGGAAAAGAAAGAAACTGCTGAT
GATGTAGTTACCGCTAATGATTAAGTGGAGGAAGTTAAGAAAGTAGTGGAAGAGGAAAAG
AAAGAAGTAGTTGAAGAGGTGAAACAGAATTAGACTGAGGAGTAACCAACAGAAGCTACT
GATGACACCAAGTAAGCAACAGATTCAAAACCCCTTAACACCAAGGGGTCAAAGGATAGT
AAATAGAAGAAACAGCCTGCCAAGAACCTAGAAGAGAACAAAAGCGATGAGGAAAGTGAT
GAAGAACTGGACAAGGAAACCTTGAAAAAGTAGAAAAGAGACAAGCGTAAAGAGAAGAAA
CAGAAGAAAGTCGAGGAGGAAAAGCAGCCTGCATTGTTCTGTAATGTGTGCTAGACTGGC
TTTGAAACCAGAAACGCCCTCTTTACACATATAAAAAAGACTGGTCACGCCAGAGCAGTC
TGA


>Contig19437.0.g14(protein)
MSKLKTCYYEVLGVDETATQKDIERGYKKSALKWHPDKNKEEDTTEKFQAVSEAYTVLSD
PNERAWYDSHKEQILSGKEHEEMKEEDFEYLTKSDLWPFFNQSCYSGYDKKKENNFYKVY
QDLFRKLDKEEEDEEEVGQDHYQAPYFGDQDSCAEEVFRFYEHWVHFSTLKQFTYADKYN
PNHAPNRQVKRLIEKENTKERSKERKEFNDLVIQLVEYVRKRDVRYQKFKIQEQREKEAK
RQQKEEELAKKRAEDQERLRKYREDIALQYAKEEEKALAEGNYEEVLVHEFNCGICKKFF
KNEKQMENHLQSKKHKDNYNKFKSEVNLDEETEKLIYEEQERLKQLQEEEENEKKRKILE
ELENQKKKKTRPNKQNQNDDEESTTPQNDDENDEADKKVNGNQDDKTLKQKQQEETQKQE
EEEEQYVSKNKLKKKSKEQDKKGAKKVAGGPQTIKQQFLKMPKDEQEILIQKLEKISGGV
KDKDQQPAKDTKGGKKKKKGKESDDEEEEKFIQQQQQKKPQKGGKNQKEQPPQAQPEMIK
TQKQKGQPQPSKKKEHLNTKEKQADDQQDNEEEEKKETADDVVTANDQVEEVKKVVEEEK
KEVVEEVKQNQTEEQPTEATDDTKQATDSKPLNTKGSKDSKQKKQPAKNLEENKSDEESD
EELDKETLKKQKRDKRKEKKQKKVEEEKQPALFCNVCQTGFETRNALFTHIKKTGHARAV