Identifiers and Description

Gene Model Identifier

Contig16392.0.g42

Standard Name

DNAJC2

Aliases

Contig16392_0_g42

Description

DnaJ domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGR285C5.999333866290414e-37ZUO1 SGDID:S000003517, Chr VII
from 1063153-1061852, Ge...
T. thermophilaTTHERM_004906709.997019043202629e-21DnaJ domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16392.0.g42(coding)
ATGGTTGAGTCATACAACAGCAATACTATTTCTTCGGAAAAGTTGGGTTATTTCAGAATA
AATGGGATGCTTACCCTTCCAAACATCGATATGGAGTTGAAGAAGTCTCTTGGTCATGAA
AACGCATTCATGGTCATAGATGAGATGACCTCATGCCCTGACTTTAAGAGGTCTGTGGAG
CAAGTAGGTTCAGCTTACGAAAAGCTTAAAGCGCGGGTACACAAATAAAAACTCAGAGAA
GAGAACAAGCACATGAAACATGGATAGAAACATCATCATGTCAGCGACAGTGAGGATTCA
GGGGAAGAAGTCGAGGCTGAGAAAACCTAGGAAGACTTCAATCAGGATTGGGAGAAGAAA
CGTAAGAAGAGAACCAAGGAGGACATTGAAAAAGAAGCATTGTTGATGGGAGATCTCTAT
GCTCTTATGGGCTTGGAACATCTTACTTATGAAGCTGGTGATGGTGATATTAAGTCATCA
TATAGAAAGCTCGCTTTGATGTATCACCCTGATAAGATTGGAGATGGCATTAGTGAAAAA
GATAAGGAAATATGGTTGCAAGTTCAAAACGCCTATGAAACACTCATTGACCCTATTAAG
AGAAAGAAGTACGATTCATCATTGCCTTTCGATGATAGTATTCCATCAGAAGCCCATTAC
GTGATCAACGCCGATACTTTCTATGAGCTTTTCGAACCAGTATTCAAGCGCAATGCCAGA
TTCGCCAAGAAGAAGCCAGTCCCTAACCTCGGAGACAAGGACATGCCAATGGATTTAGTG
TACAAATTCTATAAATATTGGGACAACTTCGACACCTGGAGAGACTTCTCACAGTACGAT
GAGTATGATGTAAAAGAAGCACAAGATCGTTATGAGCGCAGATATATGGAGAAGGAGAAC
AAGAAAATCAGAGACAAGTATAACAAAAAAGAGAGAGCAAGACTTATTAGACTCGTTGAT
ATGGCTTATAAAAATGATCCCAGAATCAAAGAGGAAATTGAGAAGGAAGAGGCAGAGAAG
CTCAGAAAGAAGGAGGAGGTTCGTATGTAAAAGCATAGAGCAAGATAGGAAATCGAGGAT
AAGATTAAACAACAAGATGCGATAAAGCAACAAGAAATCGACAGATAGAATGAAGAGGCA
AAGAAGGTCAAGGAAGTTAGACAAGCTCAAATTGTAAAGAGGAAAGAGTCTGTGAAATTG
TTAAGTCAAATTTGTGAAGAGAGAGCAACAGGCACAAATTATGATAGATTCTTCGCAGAG
GAGTTTTGCAAAAAGCTGAAAACTTAAGATGATTTGGATAAATTTATCGGAGGTATCAAG
CACATCGAAGATTCTGATTAATTCAAGTAAACCCTCGAAGACCAAATATAAGCTGTGACT
GGTCAAACTCTTGTGAGTTAACTGTAAAAGAATAAGGTGGAAGAGAAAAAGCAAGATGCT
CCAAAGGATAACTGGACATAAGAAGAGCTCGCATTATTGAGTAAAGCTATTGTAAAGTAC
CCAGGTGCCGTATTAAACAGATGGAAAGTTATTACTGAGCACATAGGCGGCACTAAGAAT
CTCAAATAAGTCATCGCTAAGGCTTAAGAACTTGCTTAAAAAACAAGTCTTTCTAAAGCT
GGCAAGACTGTATAATCATCCAGCTTTGCTCAGAAAGAAGCCAAATAATAAGCACAGGCT
GAACCAAAGGTTGAAGAGAAGAAGAGTTAACCAGCTCCCCAATCTTAACAGTAGGCACCA
GCTGACTAGGCAGTACCAAATTGGTCACCTGAATAATAAAAAGAGCTTGAGATGGCTATG
AGAGAGTTCCCAGGAAGTATTCCAGTAAAAGAGAGATGGATTAAGATTGCAGAGAAGGTT
TAAGATAAAACTGCTAAAGAGTGCTATGAACGTTTCAAGGAGATTTGTGCTATGGTCAAG
AAGCAACAATGA


>Contig16392.0.g42(protein)
MVESYNSNTISSEKLGYFRINGMLTLPNIDMELKKSLGHENAFMVIDEMTSCPDFKRSVE
QVGSAYEKLKARVHKQKLREENKHMKHGQKHHHVSDSEDSGEEVEAEKTQEDFNQDWEKK
RKKRTKEDIEKEALLMGDLYALMGLEHLTYEAGDGDIKSSYRKLALMYHPDKIGDGISEK
DKEIWLQVQNAYETLIDPIKRKKYDSSLPFDDSIPSEAHYVINADTFYELFEPVFKRNAR
FAKKKPVPNLGDKDMPMDLVYKFYKYWDNFDTWRDFSQYDEYDVKEAQDRYERRYMEKEN
KKIRDKYNKKERARLIRLVDMAYKNDPRIKEEIEKEEAEKLRKKEEVRMQKHRARQEIED
KIKQQDAIKQQEIDRQNEEAKKVKEVRQAQIVKRKESVKLLSQICEERATGTNYDRFFAE
EFCKKLKTQDDLDKFIGGIKHIEDSDQFKQTLEDQIQAVTGQTLVSQLQKNKVEEKKQDA
PKDNWTQEELALLSKAIVKYPGAVLNRWKVITEHIGGTKNLKQVIAKAQELAQKTSLSKA
GKTVQSSSFAQKEAKQQAQAEPKVEEKKSQPAPQSQQQAPADQAVPNWSPEQQKELEMAM
REFPGSIPVKERWIKIAEKVQDKTAKECYERFKEICAMVKKQQ