Identifiers and Description

Gene Model Identifier

Contig20642.0.g14

Standard Name

DNAAF2

Aliases

Contig20642_0_g14

Description

pre-RNA processing PIH1/Nop17

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001452505.0012639607461234e-61conserved hypothetical protein
SGDYHR034C0.000019995566179747357PIH1 SGDID:S000001076, Chr VII
I from 177999-176965, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20642.0.g14(coding)
ATGAATCCATACGCTTCCGAAGATTTCAACCGCATGAAGGTCAAGGGTACTCCCAAGCCT
AAGCCAGAGCCTGAAAATGAGAATTAAATTGATCATCCTTTTTTCGAGGGAAAGAAATTG
GAGATGTCTAAGAATGAACTTAGAGCATTTACAAAGGCCATGGAGCAACCTGAATTTAAA
GACATGTTGGCGGATTACGTTAAGGAAATCTCTGATCCAGGTAACAAAGCAGAGTATGAG
ACATATCTTAGACAACTCGAAGATGCTGGAGATCTTCCAATAGGTACCAAGTTAATTGAA
CCAACAGGTTTGTTCTGCATAAAAACTACAGCCAAGAAATTGATAAGTGACACTAACAAG
CAATTCTTCGATCAAAAGACATTCATTAATGTTTGCGTGCATGAGGATGTAGAGAAACCA
AGAAAGGAATATGTGAAGATGCCTGATGGTAAATCTGGCTACTCATGGCAACTACCCTAC
AGAGTGTCCAAACCTCGTCATGATTAAGACAAAAACGGTGCTCTATGTTCCACTTTCGAT
ATAGTTTTCCACAGTGACGTGGGAAGTTTCATAATTCACGATGACTTTAAGAAGTTCGTA
TCAGATACCGCCATCGATGGAGTGAATAGAGTAATGGCTGAACACAAGGAAAAGTGTTCT
AGCGACTATAAAATCATGAAACATTTGCAATGTAAAGGTGGGAAGCCTGGTTTGCTCACT
ATCAAAGTGTAGACTGAGAATAAACTACTAGCTAATGCAGATGTTAACAAACATGAAACT
AAACTCTAGAAAGATATAACTAATCAGACTGATGAGTTTAAAAAGTTGCAATAAGAGGAG
GAAGAACTAAGAGCTAAGGCTAAATAAGATGCTAAAGCACTTGGTGAAATCGATGATGAT
GACGAAGACAAGGAAGAGGAAGAGCAAATGCCAACAAGTGTCGTGAGACCTAAATACAAA
ATTGTCTTCTCTTACCCAGCAAACATAGAGGATACTTGGGAAGGTTTCAGCACCAACGAA
GGATTTAAAAATAAAGGTCTTGATCACAAGATCCCCAAAGAATTGACAATCACCATAAAC
GTCCCATTCATAGAATCTATGAAACTGGCAAAGTTAGACATAAACGAGACCAACATGATT
TTCGAATATCCAGATCTCTATTATTTAGATTTGAATCTAAAGTATATCTGCAACTGTGCC
AAAGGAACCGCCAAATTCGATAAAAGCAAGAAGACTCTTACAATCAGAGTGCCAATCACC
GGCTTAACAGAAGATTCATAGAAGGTTTATTCAGAGAACATGACTAAATACAACGAAATC
TAATAGAGAAAGTATAATGAGCTGGAAAGATCAAAGAGAGAAGAAGAGGAGGATAAGAAA
AAGGAAGATGAAGCTGCAGTCAAGATAAGTTAGTCTTAAGAAGCTGGTTCTGGAGAATCC
ATTCAGAGAATTCTACCAAGTATTGATGTGATTGGAGGAGATCTTGGAAGCAATTTCTAA
ATGAACTCTGATGAACTTGTTGACTTATAGAAGTTGCAACAAGAAGCTTTGAAAGAAGGA
GATGGATAGAATACAAAAGTTGATGAAACAACACAACACAGAGAAAACTTTCTTAAAGTG
TATTCAGAAGACAAAGACACTCTCAATAAAAATAACGATGATGATGATCTTTCAAACTTA
AAAGATATCAAATTCAAGCAGAACTTAGATGAAGATGATGATTCACAGTCTAATATCAAA
ATCACAGGTATTAATGACAGAGATGTTGGAAAGAAACCTTTAATTTAAGAGATTAAAACT
ACTTCAAATACAACAACTTAGGTAGATTCTAATGCGAATAATTCTTTACCTGAGTCTGAT
TAAAAACCAGTTACTTTATAAGCATAAACTGAAATTAAAGCGTTTAGCTGGGATACAGCT
GAGAGAGTAGTTGCTAAATATCAATTTTTCCATTAGAAAGAGCTCGTTTTCTTAAACTTA
AACTTTAAAGGCTACAATAAACTTACTGATGTGCGTTATGCTCTCTCTGAAAACGAACTT
CTCTTGGAAGTTTGGCACCCACCTCAATCTAACTAAATTCACAGAATGTGCTATACTTTG
AACAAGGAAGTTGACGTTGCCTAGTCAAATATCGACCTGCTAGTTGACTTCATTTCCATA
AAGTTGAAGAAATAAGATAAAGACAGCACTTGGAATTCAGTTGGGTATGAAATCAGTGAC
TTTACCATCCCACTTAAGGGCTAAATGAAGTCAAATTTCTTAAAGCATGAAAAGCCAGTT
TAAAATGTAGCTTCAAACCACAATGAAGACAAAGAGAACATCAACAATGACAATAAGTAG
GTAGATGATGGTAACAATGGTTTAGATGATAAACAGAATGTTGAAAATCAGTAAGTGGAG
TAATTGCAGAACGAAGTGACAAGAAAGATAGATACAGCTCAATTGAACTTTATGAATTTG
GACTCATCTGTTATCTTCAAAATATACTGA


>Contig20642.0.g14(protein)
MNPYASEDFNRMKVKGTPKPKPEPENENQIDHPFFEGKKLEMSKNELRAFTKAMEQPEFK
DMLADYVKEISDPGNKAEYETYLRQLEDAGDLPIGTKLIEPTGLFCIKTTAKKLISDTNK
QFFDQKTFINVCVHEDVEKPRKEYVKMPDGKSGYSWQLPYRVSKPRHDQDKNGALCSTFD
IVFHSDVGSFIIHDDFKKFVSDTAIDGVNRVMAEHKEKCSSDYKIMKHLQCKGGKPGLLT
IKVQTENKLLANADVNKHETKLQKDITNQTDEFKKLQQEEEELRAKAKQDAKALGEIDDD
DEDKEEEEQMPTSVVRPKYKIVFSYPANIEDTWEGFSTNEGFKNKGLDHKIPKELTITIN
VPFIESMKLAKLDINETNMIFEYPDLYYLDLNLKYICNCAKGTAKFDKSKKTLTIRVPIT
GLTEDSQKVYSENMTKYNEIQQRKYNELERSKREEEEDKKKEDEAAVKISQSQEAGSGES
IQRILPSIDVIGGDLGSNFQMNSDELVDLQKLQQEALKEGDGQNTKVDETTQHRENFLKV
YSEDKDTLNKNNDDDDLSNLKDIKFKQNLDEDDDSQSNIKITGINDRDVGKKPLIQEIKT
TSNTTTQVDSNANNSLPESDQKPVTLQAQTEIKAFSWDTAERVVAKYQFFHQKELVFLNL
NFKGYNKLTDVRYALSENELLLEVWHPPQSNQIHRMCYTLNKEVDVAQSNIDLLVDFISI
KLKKQDKDSTWNSVGYEISDFTIPLKGQMKSNFLKHEKPVQNVASNHNEDKENINNDNKQ
VDDGNNGLDDKQNVENQQVEQLQNEVTRKIDTAQLNFMNLDSSVIFKIY