Identifiers and Description

Gene Model Identifier

Contig21922.0.g18

Standard Name

DNA2a

Aliases

Contig21922_0_g18

Description

DNA replication factor Dna2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR164C3.0013534825799953e-36DNA2 SGDID:S000001207, Chr VII
I from 429178-424610, Gen...
T. thermophilaTTHERM_001360302.9990874792167046e-33hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21922.0.g18(coding)
ATGGAGTCTAATAATCGCCCACAGTAACCATTCAAGAATAAACCTGGTGAGGGTGGAATA
GTAATCAGGAAAATTACGCCAAAACCATCACCTTAATAGCAGCAGCAACCCATTTTATAA
TCAGAGACACAACTGCAAAATAGCAAATAAACATAGTAATTTATGCAATAATCTCAGAGT
TTCAATAGCAATAGTCAAAATCAAATGTAGATGATGAGTGGCGGCAGTCTTAATCGAAGT
GAAAATATTTTGTAGGAAGGTTCAAATGAAGGTTAAAGCTCTAAGAAACGCAAATTTCCA
TACCCAGAGACTTAAGAGCAGCTGGAGAAGATTTAAGAGCAAAAGCAAATAAACGCCAAG
AGATTGAAGCAAAATGATCAGTTGATCAACAAATCTGATCAAATCAGCGTCTACAGCGGC
AAAAATAGTCACAACCTGAATGAAAACTCTCTCAATACCATGAATTTGAAGCACCAATCA
CACAACTTATTAGCACAGCGTAAGTTAAGCAATCACAGCAGTAGCAACAGCAACGTCTCC
TTCAAACATATACCAATAATGAGTGTCATGAATAGTAGCACTCCCCCAAATCAAGGCAGT
CATGGGAGGAAGCTCAGCAGCAATATGTTGTCATCATCAGATAGTATTGACTTTGATAAA
CTGGAGGAGTTTATTGATCTCACTGATAGTCAACTTATACTCAATAACTAAGATGGTGTG
GATGATCAGAACAAGCAAGTGTAATCCCGAAACATGTCTATTGGTTCTAATGTACTTCGC
CAAATTGAGGAAGATATAGAGAACGAAGAGAAAGAGGAGGAAGAGCACAAATAGCTATAA
ATCAAAAATAATCATTAGAGCCAACAAAACTCGCATCAACAGTAATAATAAATCATACAA
ATTGAAGATAGTAGCTAGTCTAATAAATATGATTCAAGCTCAATTTTAACAATATCAGCT
GATTAATTTACTGCAATTTAAGATAAAAACTAGATCAAGTAAGGTAATAAGTTTGAGACT
TAATAACAAGTTCACTCTGATCAGCCTTAAGTGAAGAAAGTTTTACCGGAATTCTTCCTA
AACCGATGTTTCTACATTACAAAACTCACCTAGATAAACCCCTTCAGTCTAAAATTAGAA
TTAGACCTCGCTCCACCCCTTGATTAAAATGGTGTTCCCATTAGAAAGGAAGTGAGTGTG
AAATGCAATATTGAGTTTAGACTCAATATTATAGGCAACTGGGCGAGGAAATTGTTCGCT
GAAGTTGGGGATATGGTGCGAGTAATAGGCAATTTCTGCTTGGAAAATAAGTTTTAACTC
ATCTTAGATGATAATGAATAAGAACTCACCATCAATAAGGCAAGCATGATTATAGTAGAG
CCATACATTATGATTCCCTGCACATCTATTGTGAAAGCCTTCCCATGTGCTAGAAACGCC
CTACTCTCTCATTAATTCAAAGGCTTGAATACCGATATAAACTATGCGCTCGTCCTTGGA
AACACAATTCACGGAGTGTTTCAAAGTATTCTGTAAAACATGGACTTCAAGAAAGAAAGC
TTATAGAAAATGGTCAAAGAAGCTATTCAAGATTAGCTACTATATCTGTTCTTTTTGAAG
AAAACTGAGTAAGAAGTGCAAATTGATGTTGAGAGAGGTGTTTAAAACATTACAAAGTGG
TTGAATATGATGTTTAGAGGGGACTTCAATTAATATGGCATAAAGTATAGGAAGTTCCTA
GCTGCAGAGTAAGAATTCAATACTCACACTTATGGTATCAAGGGAAACATTGATTCTACC
ATTCAAATAGAGGATTCTGAGGGAAACATCAAATCTACAGCTCTTGAGATAAAAACAGGC
AAAAATAAATCAAATGCCTATAGAGGTCAAGTTTTGCTCTACTCACTGATTATATCTGAG
AGATTCAAAAATGCAAACCCAGAAAATATCTTACTGTATATCATGGACTAAAATGTGGCA
GATGGTTTCTAGTATATCAGGTAGAGTAAAATTGAATTAGATAATATAATTATGGGCAGA
AACGAGTTAGCTAAATGGTAAAAATCAAATAACAGCACCAATATCTAGTTGCCAACCACT
TTGAAATCTTAATAAGAGTATGAGGATTTAAACAAAGATGAGAAAGCAGTGTTTGACTAT
TCAATAAAAAACCTTAATCTTATTAAGTACCCATAAATGATAAAATAAACCTCAGAGTGT
AAATATTGCTATGCTAGAAATGTTTGCACAATCACAGCCCTGACTTTAGAACCTGAGGAC
TACAGAAAATCCCCAGCAGGTTAGTTCCCTACTTTCTAAGATATGGAGAAGACTCTAGAA
ACCAAAGTGAAACTGTACTATAAGAAGTTTGTGGAGTGCATATAATTAGAGTAAAACGCA
GAGACAGACAGAAATTCAAATTAAGCCAATAAACAGAGTTTCTAAAGAGAAACCAACTTG
AAAATTGTTAAAGTAGTCTCAAATTAGAAGGGTGGAAGTTTAATTACTTTAGAGAAGGAA
TTTATTGAACCAGCATTAGAAAGTGAGAAAGATACTAGTCAAATACTTTCAGAAAGTACA
TTCGTAAATTTGTATACTAAAGGGAATATTACCTTTTCTAAGGGGTACCTTATTTCTAGA
GAAATTGACTTTAAACCAAAAACTTTTACAGGTGACTCACCCTTAAAAAGTTAAAATAAC
CTGGACAATCCTATACAGATCGAGGACTCTCAAGTGTTACTTGAAGATATAGAAAATAAA
ATGCAAGATATAGATAAGTATTTCTGTTAAGTAGTCATTTACACTATTGAATTTGCTCAT
CTTATGCCTTAAAACCTGAGCAAGGATGCCCTCGGAGGAAAAGACCCCTTATCTCAAAAC
TAGGAAGAATAAGTTATTTGGACAATCGAAAGTGAACCATTTTCAAATTTTTCATATTCT
ATGATGAGAAGTAACATCCTCGCTCTCTGCACTGATAACAGATTTGACAAGCTAAAAGAT
CTTTTAGTATTGAAAAAACAAACCTATGAAATCCCAGAGAAGCATATAAACATGGTTACT
TAAAAGTTCAAGGATAAAATGATGAATTTAAATGATGATTAGAAAACTGCTATCAGTAAA
AGCATATTGTGCTAGGACTTTTAGATGATATATGGTGTCCCTGGTTCTGGTAAAACCTAG
ACTATAGTTACTTTGATTAATATACTTGCTAGTATCAAGAAGAAAATATTACTAGTGAAC
TTCTCAAACTAGCAAGTTGACAGTTTGTTAGTAAGTTTGAAAGAAAGTGGGTTTGAAAAT
TTCACTAGAATTTCTAGCAATGCATCTTCAGTAGATCAAAGAATTAGAGATAAGGTCATT
ACTTCTAGTACTTTCACTTCGATGCAGCAAATCACAGATTTTCTAGATCAGACATTTGTC
TTTGGCATGACTTGTCTCTCAATGAACAACCCAATCCTACTCGCAGTAAAGAAATTCGAC
TATTGCATATTCGATGATGCAGAATAGATATCTGAACCACTGGCTCTTGGACCAATCATA
ATAAGTGAAAAGTTTATAATGGCTGGGGATTTCAAGCAGCGTAGCATTCAAGTTAAGTCA
TTTATTGCTGAGAGAAAAGGCTTAGGGAAGAGTTTGTTTGAGAGATTATGTGAGGAACAG
AAGTCAAATTTGACTAAGTTCAAGGTATAGTACAGGGTTAATAAAGATGTAATGGAGGTT
GCTAATAAACTAAATTACAATGATGAAATGATTTGTAACCTGGACAATATTGCTTTACAA
AGAGTTGTTTATCAACCAAGCATCCTTCAAGCTTAGAGGGATCAAAATCGTCATTGGTTA
GATAAAACCCGTACTAATTAAGTTCTAATAATAAACCCTGATAACATAATTTCTAAGATC
CCCTTGTCTCACAGATAATCAACAATAAAATCCAAGAATTTCATAGAAGCTTCAATAATA
GAGATTATACTGAAAGATTTATAAGAAAATGCTGTTTCAATGCCAGATGAAGGAAATTCT
TTGAAAGTAGCGGTTGTCGCTGCAGGTTAAGACCACTCTAGTTATCTTAATAAATAACTG
AAAGCCAAGCCATAAAATTAGTAAAAATCTATTATTAATAACGATAATTTGCATGAGCAA
TAATAGCTTCCTCTAGATTAGTAAATTGGAGCTGATTAAATCTAGCAACAATAATCAAAA
TTACAGATAGATCTACAAATAACCTCAGTAGATAGAGTGGGAAATTAGCTTGATTGCGAT
ATCTTAATATTTTCATGTGGACTATGGTCATAAGGAGCAGACAAAAACTTAATTCAATAA
ACTAATTCTAAAACTGCTGAGGAACTAAAAACTACAGAAGAAATTAAGGAAGATCAAGTG
AAATCATAGCAATAAGTTAAAGAAGAAAAGTATTAACCTATAAAAGACTTTAAGAAATTG
AATTATGTGCTGTCAAGACCCAAGAAAAAATTGATAGTCATTGGATCCAAAGAAAATTTG
AAGCAATAAAAGCAACTCTATAAACTGTTTTTAGCTTGCAAAATGAAGGGTTGGTACACT
GAACTTGAAGAAAATGATTTTTATATAATGATGAACCTCTCTGATGAAAATAGGTAGTAC
TTCAACAATGAATAAATATCAATTGGAGATATCCCAAATCAATGA


>Contig21922.0.g18(protein)
MESNNRPQQPFKNKPGEGGIVIRKITPKPSPQQQQQPILQSETQLQNSKQTQQFMQQSQS
FNSNSQNQMQMMSGGSLNRSENILQEGSNEGQSSKKRKFPYPETQEQLEKIQEQKQINAK
RLKQNDQLINKSDQISVYSGKNSHNLNENSLNTMNLKHQSHNLLAQRKLSNHSSSNSNVS
FKHIPIMSVMNSSTPPNQGSHGRKLSSNMLSSSDSIDFDKLEEFIDLTDSQLILNNQDGV
DDQNKQVQSRNMSIGSNVLRQIEEDIENEEKEEEEHKQLQIKNNHQSQQNSHQQQQQIIQ
IEDSSQSNKYDSSSILTISADQFTAIQDKNQIKQGNKFETQQQVHSDQPQVKKVLPEFFL
NRCFYITKLTQINPFSLKLELDLAPPLDQNGVPIRKEVSVKCNIEFRLNIIGNWARKLFA
EVGDMVRVIGNFCLENKFQLILDDNEQELTINKASMIIVEPYIMIPCTSIVKAFPCARNA
LLSHQFKGLNTDINYALVLGNTIHGVFQSILQNMDFKKESLQKMVKEAIQDQLLYLFFLK
KTEQEVQIDVERGVQNITKWLNMMFRGDFNQYGIKYRKFLAAEQEFNTHTYGIKGNIDST
IQIEDSEGNIKSTALEIKTGKNKSNAYRGQVLLYSLIISERFKNANPENILLYIMDQNVA
DGFQYIRQSKIELDNIIMGRNELAKWQKSNNSTNIQLPTTLKSQQEYEDLNKDEKAVFDY
SIKNLNLIKYPQMIKQTSECKYCYARNVCTITALTLEPEDYRKSPAGQFPTFQDMEKTLE
TKVKLYYKKFVECIQLEQNAETDRNSNQANKQSFQRETNLKIVKVVSNQKGGSLITLEKE
FIEPALESEKDTSQILSESTFVNLYTKGNITFSKGYLISREIDFKPKTFTGDSPLKSQNN
LDNPIQIEDSQVLLEDIENKMQDIDKYFCQVVIYTIEFAHLMPQNLSKDALGGKDPLSQN
QEEQVIWTIESEPFSNFSYSMMRSNILALCTDNRFDKLKDLLVLKKQTYEIPEKHINMVT
QKFKDKMMNLNDDQKTAISKSILCQDFQMIYGVPGSGKTQTIVTLINILASIKKKILLVN
FSNQQVDSLLVSLKESGFENFTRISSNASSVDQRIRDKVITSSTFTSMQQITDFLDQTFV
FGMTCLSMNNPILLAVKKFDYCIFDDAEQISEPLALGPIIISEKFIMAGDFKQRSIQVKS
FIAERKGLGKSLFERLCEEQKSNLTKFKVQYRVNKDVMEVANKLNYNDEMICNLDNIALQ
RVVYQPSILQAQRDQNRHWLDKTRTNQVLIINPDNIISKIPLSHRQSTIKSKNFIEASII
EIILKDLQENAVSMPDEGNSLKVAVVAAGQDHSSYLNKQLKAKPQNQQKSIINNDNLHEQ
QQLPLDQQIGADQIQQQQSKLQIDLQITSVDRVGNQLDCDILIFSCGLWSQGADKNLIQQ
TNSKTAEELKTTEEIKEDQVKSQQQVKEEKYQPIKDFKKLNYVLSRPKKKLIVIGSKENL
KQQKQLYKLFLACKMKGWYTELEENDFYIMMNLSDENRQYFNNEQISIGDIPNQ