Identifiers and Description

Gene Model Identifier

Contig4225.0.0.g49

Standard Name

DMC1

Aliases

Contig4225_0_0_g49

Description

Rad51

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYER179W2.0004261429631518e-110DMC1 SGDID:S000000981, Chr V f
rom 548421-548552,548645-...
T. thermophilaTTHERM_001423302.9992439173235726e-110DNA repair protein RAD51 conta
ining protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4225.0.0.g49(coding)
ATGTGTACCAAGAAAGACATGCTCAACATCAAGGGTATCACAGACTAGAAAGCAGAGAAG
ATCTATGAAGCTGCATCTAAGATTGAAACTATGGGGTACGTAAGCGGCATGGTAATCATG
GAGAAGAGAAAGAAGATCAAGAAGATTTCTACTGGCTCAGCAACCTTTGATAAGCTACTC
TAGGGTGGAGTTGAAAGTCAGGGGATCACTGAAGCTTTTGGGGAATTCAGAACTGGAAAG
ACTTAGTTAGCTCACACTTTATGTGTGACTGCATAATTGCCAAAAAGTTAAGGTGGTGGG
GAAGGCAAAGTTTTGTACATCGACACTGAGAATACCTTTCGACCAGAGAGAATCAAGCAA
ATTGCTAGAAGATTCGAGCTTGATCCAGATGAAGTGTTAAACAACATAATGGTTGGAAGA
TCTTTCACTGTTGACAGTTTGAACACTTTGATTATGCAAGCTGGAGGTGCAATGATTGAA
GATTAGTTCTCGCTTTTAGTGATTGATTCAATCATGGCACCTTTCAGAGTGGATTATTCT
GGAAGAGGAGAGCTATCAGAAAGACAGCAGGTCCTAGGCAAGGTTCTGAGCAAGATTCAG
AAGATCAGTGAGCAATTCAATGTTGCGGTTTTTCTGAGCAATTAAGTTATGGCTGACCCT
GGAGCAAGTATGACTTATGCAGCAGATCCCAAGAAACCCATTGGTGGAAACATTCTTGCT
CACGCTTCTACAACCAGACTTTACCTGAGAAAAGGCAAAGGTGAGCAAAGAGTATGCAAG
ATCTTTGACTCTCCATCAATTCCTGAAGGAGAATGCATTTTCCAAATCAGTGAGGGCGGT
ATCATTGATGCTATTGATTGA


>Contig4225.0.0.g49(protein)
MCTKKDMLNIKGITDQKAEKIYEAASKIETMGYVSGMVIMEKRKKIKKISTGSATFDKLL
QGGVESQGITEAFGEFRTGKTQLAHTLCVTAQLPKSQGGGEGKVLYIDTENTFRPERIKQ
IARRFELDPDEVLNNIMVGRSFTVDSLNTLIMQAGGAMIEDQFSLLVIDSIMAPFRVDYS
GRGELSERQQVLGKVLSKIQKISEQFNVAVFLSNQVMADPGASMTYAADPKKPIGGNILA
HASTTRLYLRKGKGEQRVCKIFDSPSIPEGECIFQISEGGIIDAID