Identifiers and Description

Gene Model Identifier

Contig18103.0.g54

Standard Name

DLTD1

Aliases

Contig18103_0_g54

Description

DltD N-terminal region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam04915 ) DltD N-terminal region
  • ( pfam14260 ) C4-type zinc-finger of DNA polymerase delta

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18103.0.g54(coding)
ATGTATCATCTCGAGGTATTTTTGAATACTTTCCCAGGAAGTCAAATTGAGAGTTTGTAC
TCTAAGAGATTGCTATACTTGATTGAAACAAAAAAGCATTTTATTCAGATTCATGTTGTA
GATGTTAACACTGAAATTTCAAATTTAAAGCTAAATCTTGATAGTCTTAATTTGGATAAT
TCAGACAAGATTTTGAAGGAACCTCAATTCGATATGAAAAATATTAGAGAGTATATGTTT
GAGAAGTACAGACTGATCAAGAATACTGAAGATTAAGTGATTATGCTCCCATAAGTATAC
TTGATTTAAACTCCAGTAATTGAGCAAAAGAAGTATGTTCCTACTATGCCCAGTTCAACC
CTCAAATAATTTGACACAAGTAAACATAAGAAATCGAGATCAGAACTTCCTTCTTCCCTT
ATCTTGCAAAATTCTGTTCTTTAAAAAGCTGCTTAGTAAAAACTTTAAACTCTTCCTTTG
AGATATTACCTTGGTGATTATTTGACTATTCAGTATTTAGAAGACTCTGGTATCTTGGAT
TAAATTCTGACTGGTATGATTTGTCCACACTATAGAGTTTTCAAAAGTAAACCTGTATTC
TAATTCTGTAAAACTCAATAAGATACTCATACCGCAGTTGAGATGTGTACCTCCTGTTTC
CTTGAGAATTAATTGTGCCCAAAGTATTCTGGGAAAGACTTTAAGAGTCTTTTGCTATCA
GGAAAGACTTGCATCTAAGATTGGAGAGATGTAATCATTATTTGTAATTTCTCGGACAAT
TTAAGCAAAGAATGCAATGACATTTCTCTCTTCTTTGAGAAAAATTTCATTCCATTTAGA
TTGATTGATCCTTTATAGATTAACTTTGAATTCACTCCTATCTATTCATAAGAATACTTT
AACTAGAAATTCTTGAAAGAACATAACTATGAAGTTCAAAACTCATCTCTTCCCTTGATT
TTTATTCATGATACAAAAGTTTCTCTTGAAAGTGTAATTGAGATGGCAAAGAGAGGTACT
TTGTTAAATATTTTGAGAAAAACTAGATGCTTGAAATGCTAAAAGAAACTTGTTGTCAAA
AAGTAATCTGCTTTTGAATAGAAGTCTATGAAATAGAATTCCCTAGATCATCTTTGCAAA
CAGTGTTAACAAAGTGACAATGTATAACATAAAGTATCTCATTAAAATCAGGCTATTATA
CCTTCTAAAACTGTTACATACGCTTCAAATGACTAAACTAATCAAGATGCAATGACTTTG
AAAGAGAAAATCTTTTTCTCAATGAATCTATCAAAAGATAATCCCTAAAACTCTTAGTTA
ACTAACTTTCCCAAACAAAATCCCTAAGTTTTACATTAATAATCAAATAACAAGATTAGT
GTTTCAAGCAAACTCCGTGAGTCTTTTCAACTTCAACAGATCAAACCTCAAAGTATTATG
AATCCAGGAGGAGTGTAGAATCTTGCTTTTGGTCAGAAAAATGAAAATGTTCAGCATGAT
ATCAGAAAGTCACTTGTTACTCCAAGATTGCTTAACAGACTAATTGAATTTCAGTGA


>Contig18103.0.g54(protein)
MYHLEVFLNTFPGSQIESLYSKRLLYLIETKKHFIQIHVVDVNTEISNLKLNLDSLNLDN
SDKILKEPQFDMKNIREYMFEKYRLIKNTEDQVIMLPQVYLIQTPVIEQKKYVPTMPSST
LKQFDTSKHKKSRSELPSSLILQNSVLQKAAQQKLQTLPLRYYLGDYLTIQYLEDSGILD
QILTGMICPHYRVFKSKPVFQFCKTQQDTHTAVEMCTSCFLENQLCPKYSGKDFKSLLLS
GKTCIQDWRDVIIICNFSDNLSKECNDISLFFEKNFIPFRLIDPLQINFEFTPIYSQEYF
NQKFLKEHNYEVQNSSLPLIFIHDTKVSLESVIEMAKRGTLLNILRKTRCLKCQKKLVVK
KQSAFEQKSMKQNSLDHLCKQCQQSDNVQHKVSHQNQAIIPSKTVTYASNDQTNQDAMTL
KEKIFFSMNLSKDNPQNSQLTNFPKQNPQVLHQQSNNKISVSSKLRESFQLQQIKPQSIM
NPGGVQNLAFGQKNENVQHDIRKSLVTPRLLNRLIEFQ