Identifiers and Description

Gene Model Identifier

Contig19347.0.g67

Standard Name

DLH1

Aliases

Contig19347_0_g67

Description

DnaB-like helicase C terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03796 ) DnaB-like helicase C terminal domain
  • ( pfam03630 ) Fumble
  • ( pfam09757 ) Arb2 domain
  • ( pfam10186 ) UV radiation resistance protein and autophagy-related subunit 14
  • ( pfam03534 ) Salmonella virulence plasmid 65kDa B protein

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19347.0.g67(coding)
ATGAACTACTTGAACAATTTAAAAACATCATTCTCAAGCATAGATGATTGCAACTCTATA
GCATATGAAGATAGTAATGACTACTAATATGATGAAGAGAATTTGAATCAGCAATAATTT
AGACAGCTATAGCAACAGCATTTCTAAACTAATTTGGAATTTGAGAATATCGAAGCATAG
CTGCAGCTTCTTGAAGTGCAGAAATAACATCAATCAGAAAGAGAAGAGCAGTTGGTAGAG
ATGACCAAGAAACTAAGAGTGAAAGCAAATGAATTAAAGAAGAGGGAGGATGTCCTCAAA
CAGAAACAGTGCTATTTATCATAAAAGGAAGACTCCTGGAAGATGTAAAAAGATGAAATC
AAGGAAAATGACTAAAAAAACAAGTGA


>Contig19347.0.g67(protein)
MNYLNNLKTSFSSIDDCNSIAYEDSNDYQYDEENLNQQQFRQLQQQHFQTNLEFENIEAQ
LQLLEVQKQHQSEREEQLVEMTKKLRVKANELKKREDVLKQKQCYLSQKEDSWKMQKDEI
KENDQKNK