Identifiers and Description

Gene Model Identifier

Contig17910.0.g6

Standard Name

DKC1

Aliases

Contig17910_0_g6

Description

DKCLD (NUC011) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000707809.997093137033517e-262rRNA pseudouridine synthase, p
utative family ...
SGDYLR175W9.997093137033517e-262CBF5 SGDID:S000004165, Chr XII
from 506134-507585, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17910.0.g6(coding)
ATGTCATCAAGCGATGAATCTAACCATAAGGCCACCAAGAAGAGCGGCTCAAAGAAGACT
GAGAAACACTCTAAGAACGGAGGAGTTGAGTATCAGATCAAGCCATCCACTGGTGGACCT
TCCATGGACACATCAAACTGGCCATTACTTCTTAAAAACTATGATAAGTTGAACGTGAAA
ACCAATCACTTCACTCCCCTGCCATGCGGTTGGTCACCCACCAATCGTCCCCTTCTTGAA
CACAAGAGATACGGAGTAATCAATCTTGATAAGCCATCCAACCCATCATCTCATGAAGTC
GTTGCTTGGATCAAGAGAATTCTTAAAGTTGATAAGACTGGTCACTCTGGTACCTTAGAT
CCCAAGGTTACTGGTTGTTTGATCGTTTGCATTAACAACGCCACTAGACTTGTGAAAGCT
CAACAATCAGCTGGTAAAGAGTACGTTGCCATCGTTAAGCTCCATTAACACGTCGAGAAG
ACCAAGACCCTCGAGAAGGCTATTTAAAGCTTGAATGGTCCAGTTTTCCAAAGACCACCT
CTTATTTCCGCCGTCAAGAAGGAATTGAGAGTCAGAACTATCTATGAGACCAAGCTTTAC
GAGCACGATATCAAGAGAGATATGGCTATCTTCTGGTTGAGTTGCGAGGCTGGTACCTAC
GTTAGAACCATGTGCGTGCACATCGGTTACTTACTTGGATGTGGTGCTCATATGCAAGAA
CTCAGAAGAGTCAGATCTGGTGCTCTCAAGGAAGACGACACCATGGCCACCATGCACGAT
GTTAAGGATGCTCAATGGCACTTCGAAAAGTTCAACAATGAGACTTATCTCAGAAGAGTC
ATCATGCCACTTGAAATCTTACTCACTCAACTCCCAAGAATAGTCGTTAAGGACACTTCA
GTCAACGCTGTCTGCTATGGTGCCCAACTCATGTTGCCAGGAGTATTGAGATACGAATCA
GGTATCGAAGTCGGCAAGGAAGTCATTCTTATGTCAACCAAGGGTGAGGCCATCGCCCTC
GCTATTGCTCATATGACAACCTCCACCATCGCCACTTGCGATCACGGTATTGTCACCAAG
ACCAAGAGAGTCATCATGGAGAGAGACGTCTACGAGAGAAAGTGGAAGCTCGGTCCCTTC
GCCAAGAAGAAGGAGACCTTGAAGACTGAGGGCAAGCTCGACAAGTTCGGCAGAGTCAAC
GAGACCACCCCAGAAGCCTGGAAATTACTCTTCGGACAACCAGAAGTTGGAACCAGCATT
GATGCCGTCGCCTCAAAGCTAGGAGTTAAGAAGGAGCAAAACGGAACAGTAGCCAAGAAG
GAAGAAGCCAAGCCAGCAAAGAAAGCTGCCAAGGAAGAATCCGAGGAATCCGAGGAAGAG
AAGCCATCAAAGAAAGACAAGAAGAAGGCTGACAAGGATAAGAAGAAGGACAAGAAAGAT
AAGAAGAAGGAAAAGAAAGACAAGAAAAAGAAGAAGGACTCCAGCGACGAAGAGTCAGAC
GAATGA


>Contig17910.0.g6(protein)
MSSSDESNHKATKKSGSKKTEKHSKNGGVEYQIKPSTGGPSMDTSNWPLLLKNYDKLNVK
TNHFTPLPCGWSPTNRPLLEHKRYGVINLDKPSNPSSHEVVAWIKRILKVDKTGHSGTLD
PKVTGCLIVCINNATRLVKAQQSAGKEYVAIVKLHQHVEKTKTLEKAIQSLNGPVFQRPP
LISAVKKELRVRTIYETKLYEHDIKRDMAIFWLSCEAGTYVRTMCVHIGYLLGCGAHMQE
LRRVRSGALKEDDTMATMHDVKDAQWHFEKFNNETYLRRVIMPLEILLTQLPRIVVKDTS
VNAVCYGAQLMLPGVLRYESGIEVGKEVILMSTKGEAIALAIAHMTTSTIATCDHGIVTK
TKRVIMERDVYERKWKLGPFAKKKETLKTEGKLDKFGRVNETTPEAWKLLFGQPEVGTSI
DAVASKLGVKKEQNGTVAKKEEAKPAKKAAKEESEESEEEKPSKKDKKKADKDKKKDKKD
KKKEKKDKKKKKDSSDEESDE