Identifiers and Description

Gene Model Identifier

Contig19321.0.g57

Standard Name

DIS3b

Aliases

Contig19321_0_g57

Description

RNB domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000474409.997093137033517e-262RNB-like protein
SGDYOL021C3.0013161285558437e-171DIS3 SGDID:S000005381, Chr XV
from 285426-282421, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19321.0.g57(coding)
ATGTTGCTTACTACCAAAAGAGTAAACACTGTGAAGTTCAGGAAACTTCAAAATGGCAAA
ATTGTTAGACAAATTGAGGAATAATATCTCAGACAAGATATTCCATGTGGTCTTAAAAAC
TGCCCATTCTGTGATACTAATGACAATTGCAATTTATTACTTTAACTTAAGGAAGTGGCT
GGAGTCAAGTCAAGCATCGCTCTGAGTCAAGAAGACTAGAAGTTCTCACAAAGAATATAC
ATCATAGACCATTCTTTCGCTTTGAATCAATTCGATTTCATTGAGAATTGCAATGCCCTC
TCAAACATCATCTTAACTGACTCCGTGTTGAAGTATATTAACAGAAAGAACATTCAGGCT
TTTCACGGACTTAAAAATTTGACTGAGTAGGAATCCAGACAAATCTATTATTTGTATAAC
GAAAACTTCACTGAAACCTATGTTTAAGAGAGTTTACTAAAGGGCAAGGGTCTTGACTTA
AAAATGAAGACTAAACTTGCAGCAGTCTTTCAATGGTACTCTGACCACTTGCAAGGTGTC
GCTCAAAACAACCAGATTTTCCTTCTGACAGATAGTTACAAATCTAAGTAGGAATATCTT
AAGATGATCAAAGGTCCCTAACAAGAGGGAATCATCACAATGGAAGACTTTATCATAATG
AACCAAGAAAGTAATCCCGAGTTACTTAATTTCATGGGATTTGCTGATGAAAAAGACATG
CAAGATGTTGACATGGAAGAAGCTGATGGGGTTAGAGATCTCTATGAGGACCATTTATCA
TTTGAGGAAATGATACTTGGTATTAAGGAAGGTAGATATTTCTAAGGAAGATTGAATGTC
TCTAGAACTACTTTGGAAGAAGCCACTATTGCAATTGAATACCTAAATTAAGACTTGTTG
GTGGTTGGATTGTAAGATCAAAACAGAGCTTTTAATGGTGATATTGTGTGCTTGGAAGTA
CTTCCTGAATCACAATGGATCTCGAATTACAAGTCAAGTCAGCCAGTTAATGTACTAGAG
CAGTCTGCAGTTCAGTACATGGATAAAGCTGATGAGGTTCATGTAGAAGAGGATCTTCAA
AATCTAGAGGAATCTAATAGACAAAGACTCAATCTTATTGAAAAGATAAATAATGAGAAG
CAAAAGAGAGTGACTGCTAGAGTTAGAGGAGTACTTAAGAAAATGAATAAGACTTATGGT
GGCTCTATCATTAAGAGCTCTGATTAAACAGAAGAAACCCGTAGAAAATTTGAACTTTTC
CTTAAAAACTTGAGAGTTGAACAAAAAGATTACTTTAAATACAGAGTCTTTGTGCCCTTC
AATTTACAGATGCCTTAAGCTATTGTAAAATCTGCAAGGCCAGAAGCCCTTGAAAACAAA
AGATTCATATTAAGATTCAGCACTTGGACAAAATATTCTCCCTTCCCTCAAGGCTAATTT
GTCAAAATTATTGGAGAAGAAGGAAGCATAAAAACTGAGGGAGAGATGATACTTCATGAG
TTCAATGTGGATACCAGACCATTCAGTAACAAAGTGCTTCAATGTTTGCCAACTGATGGA
GCAAATTGGAAAATTCCCTAAGAAGAGATCGATAAGAGACTTGATATCAGACATCTAATT
GTTGCCAGTGTTGATCCTATTGGTTGTAAGGATATTGATGATGCCTTGCATTGCAGAATA
CTACCAAACGGAAATTATGAAGTTGGTGTGCATATTGCAGATGTCACTCATTTTGTGAAA
GCAGGTTCAGAAATCGATAAAGAAGCAGCTAGGAGATGCACTACTGTTTATATGGTTGAT
AGAAGAACTGATATGTTGCCTGGATTGCTCACTGAGAATTTATGCTCAATTAGAGGTGGA
ACTGAGAGACTCGTGTTTAGTGTAATTTGGGAAATCGATAGCAAAAAATTCACCCCAGTT
AAAAGTTCATTTCACAAGTCTGTAATCAAATCAGCAGCTGCTTTGGATTATTATACTGCT
CAAGATATGATCAATGATCCCAATAATAAGACCGAGTTAACTGAATCCCTCAGAAGATTA
TTGACTATAGCAAGAATTTTAAGGGATAGGAGAACTGCAAAGGGTGCCTTGACTCTGGCA
TCCCCAGAACTAAAATTCAAACTTGATGACAACCGTGAAACACCCACTGACGTCACAGAA
TACAGACATGTGGATACTCATTTCATGATTGAAGAGTTCATGCTCTTAGCTAACATAGCA
GTTGCTGAGAAGATAGTTTAGCATTATCCATCATTTGCCATTCTCAGAAGACATCCTCAA
CCAAAATAGAAAGAAGTGGCTGAATTTGTGGATTAGTTAGCTAAATATGGCTTTGAAATG
GCATTAGATAGTTCAAAGAGTTTTGCCGATAGTTTAGATAGAGCTGAGAGACCTAATGAT
CCTTACTTCAATAAGATTGTTAGAATTATGGCAACCAGATGTATGCATCAGGCAGTCTAC
TTCTGTCTTGCAGATTTCGATATCTCAGAAGTTTTCCATTATGGATTAGCAGTGCCAGTT
TATACCCACTTCACCTCCCCAATCAGAAGATATGCTGATGTTTTAGTGCACAGACTTTTA
GCTGCAGCCATCGATATTTAATCCCTGACAAATGAAATGACCGATAAATTCAAGATGGCT
AGATAGTGTGATTAAATGAACCGCAAGAACAGAATGGCAGCATTGGCTAGTCAAGCTTCT
GTTCAGTTCAACACTTATCTATTCTTTAAGGGCCTTAGAGAGAGAAATCAAAAGGATGTA
ATTGAAGATGCTATAATTATGAAGATCACCAAGGCAGGTGCTTATGTCATGGTCATGAAA
TATGGAATTGAAGGACTTATTCAGGAGGAAGAGGAAGTCAAGATTGTCGTAGATGGTGAC
AAAGAGGAAGCAATTATCAATAATGGAGTTGTACTCAAAGCATTTGACAATGTGAAGATA
GAGATTTTAGCAGTTAGCATTGAATTCAGAAGGCAAATCAAGATCCTTTTCAGAGGGAAA
TCAGACAACCAGCAATTCGACTAATTGCCCAAGAAAAGAAACAATTAGTAAAAGGAGGAG
TCCAAGGATGAGTAAAACTTGAGTGAGGCTCTGTCCAAGAAATCAAAGAAAAAGAAAAGA
GTTTGA


>Contig19321.0.g57(protein)
MLLTTKRVNTVKFRKLQNGKIVRQIEEQYLRQDIPCGLKNCPFCDTNDNCNLLLQLKEVA
GVKSSIALSQEDQKFSQRIYIIDHSFALNQFDFIENCNALSNIILTDSVLKYINRKNIQA
FHGLKNLTEQESRQIYYLYNENFTETYVQESLLKGKGLDLKMKTKLAAVFQWYSDHLQGV
AQNNQIFLLTDSYKSKQEYLKMIKGPQQEGIITMEDFIIMNQESNPELLNFMGFADEKDM
QDVDMEEADGVRDLYEDHLSFEEMILGIKEGRYFQGRLNVSRTTLEEATIAIEYLNQDLL
VVGLQDQNRAFNGDIVCLEVLPESQWISNYKSSQPVNVLEQSAVQYMDKADEVHVEEDLQ
NLEESNRQRLNLIEKINNEKQKRVTARVRGVLKKMNKTYGGSIIKSSDQTEETRRKFELF
LKNLRVEQKDYFKYRVFVPFNLQMPQAIVKSARPEALENKRFILRFSTWTKYSPFPQGQF
VKIIGEEGSIKTEGEMILHEFNVDTRPFSNKVLQCLPTDGANWKIPQEEIDKRLDIRHLI
VASVDPIGCKDIDDALHCRILPNGNYEVGVHIADVTHFVKAGSEIDKEAARRCTTVYMVD
RRTDMLPGLLTENLCSIRGGTERLVFSVIWEIDSKKFTPVKSSFHKSVIKSAAALDYYTA
QDMINDPNNKTELTESLRRLLTIARILRDRRTAKGALTLASPELKFKLDDNRETPTDVTE
YRHVDTHFMIEEFMLLANIAVAEKIVQHYPSFAILRRHPQPKQKEVAEFVDQLAKYGFEM
ALDSSKSFADSLDRAERPNDPYFNKIVRIMATRCMHQAVYFCLADFDISEVFHYGLAVPV
YTHFTSPIRRYADVLVHRLLAAAIDIQSLTNEMTDKFKMARQCDQMNRKNRMAALASQAS
VQFNTYLFFKGLRERNQKDVIEDAIIMKITKAGAYVMVMKYGIEGLIQEEEEVKIVVDGD
KEEAIINNGVVLKAFDNVKIEILAVSIEFRRQIKILFRGKSDNQQFDQLPKKRNNQQKEE
SKDEQNLSEALSKKSKKKKRV