Identifiers and Description

Gene Model Identifier

Contig21538.0.g91

Standard Name

DIS3a

Aliases

Contig21538_0_g91

Description

RNB domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003041702.000724368835138e-100RNB-like protein
SGDYOL021C9.004005705510192e-49DIS3 SGDID:S000005381, Chr XV
from 285426-282421, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21538.0.g91(coding)
ATGTCGAAATAATATCACACAGAGAAGAAAGCGACTACACAGGGCGCGAAGATCAGCTAC
GAGCGAGCTGGCTTCGTCAGGGAGGACAAGTATGTTCTCAAGTACGTACCCCAAGAACCT
AGTTACGGGAGAGGCGGCAAGAATAACCAGAGAGGAAGACCACTCAATGATTACGAAGAG
GAGGAGAAATCATCCTATACTAATTACAATGATCATTAACCAAATAGATAATGGTAGAAC
AAGTAGCAGTATGGAAACATTCAGTCAAGGTATCAGGAAGAAACCATGAATGATGACTAC
CCATACTCGACTACAGCGTCTGAATCCAAGGGTTAGAACCGCAGAGGAGGGTACTAGCAC
CACTAACAATAGCCTGCCATGGGCAGAGCAAGAGGATAGAATTCTCATTAAGATGAAGGT
TATGAGCAAGAGGGCTTAGTTTATCACAGAGCTCGTTTTGCAGATAGGGGTCGAGGTCGG
GGTAGAGGTGCTAACCAGCACTAAACCCAGGGTCGAGACAATGGTTTTGGTCAGCCTGTA
GATTTTCAGGAGACCAGAACAAGAACAAGAGGTAGAGGTAGAGGAAGAGGGCGGGGCCAC
ATGGCACCAATCAGAGACTACACAAACCAATGGGTGAAAGATGATAACACTTATGATGAC
CAGCATCACCACGAAGAAGAGCACGATAGTGAAATATTCCATCAGTCTTCTTCAAGTGTT
GCCAACGATGAAATCTTTCAGCCAAAATACTTCCTCAATGATCAAAGGAACATTGAGGAG
CTTTTTGAAGAGAAATGTATTCATGATAAGAGAAGTATGTAACAGATTAATGAATACTAA
CCTAAGACTCAAGCTTATCCAAAGCCAGAGTTTTACTAAGGACCTTAATATGTTGTTTAC
AAGTAACTTACCTCTCAGAATCGCAAATAGCGTATCTAGAGCAGTGAGCTATTTGATATT
CAATTCCAGAACAAGGAAAAGTTCGAATAAGAGCAGTAAAGATCCCACTATAACGCCAAC
GCAAGATTTGAAAAAGAAAGAGAGAAACCTTAACAAAAATTCAAAGAAGTTTATGGACAG
ACTTTCGATTTCAAGCATGAAAAAAGAACAGAAAACAAGTTCTGGGACAATCCTGAGGGG
TACTCCAAAAAATCAAGACCTCAGAAGGAAGAGAAGGTTGCAGGAGCACCAGCCAGATTT
AATCGTCAGAAAGGTAGAAAAGGGTCTGGTGGCAAAAAGGGCAACTAGAAATCAGAAGCT
AGCAAGGATAAGTTCTTCAAGAAAAGTGACGGTAAAAGAGGATACGGAGATAAACATCAG
GCTTATGAAGAGCATCTAAACGAGGAACAAATTTAAGAAGGAATCAAGCAAGGATTCTTA
TTTGAGGGAATCCTAAGAGTCAACCAAAATAATAGAAAGAGAGCATTTGTCCATGTAAAT
GACATCAAGTTCGATGTAATGGTAGATGGACTTATCCAGTAAAACAGAGGGCTTGACGGT
GACACAGTTATTGTTTAGCTCTTAGAGCCAACCAGATGGCAAAAATACGTTTCAAACAAC
GTAGTAGTTGGCAAGGATTCAATGGGCTCCAGCAAGTTAATCAGTACTATTTCAACCACC
AAGAACAGGATGGGTTACACTAATGAGACTGCAATTGAAACAAGAATCATTGATTTAGAA
ACCATTGAGTAACTTAGCCCATAAGCGTAAGTTGAAGAAGAACTTAAGGAAATTCAGGAA
GAGTTGAAACAACAACAAAGAAAAGAATCTTCTGCATCATCCGATTCTTCAGATTCTTCA
TCTTCAAAATTGTCACACTCTAGTGAAGAGAAGTAATTGAAGAAAGAGACAGTCGAATCA
AAGTTAGACAAATAAGATGATCTTGAAGAAGAGGAAGACGTTGGATATGGTATGCTTGAA
GATGAAGAGGTTTCTTCAGAATCATCTGAAGAAGAAGCTAAAACACCAAAAGATAAGAAA
CTTCAAATGATCAAGGAAGAGTCTAGCAGATCAGCCAAGGTAGAAAGAAAACAAAAGGAA
ATTGTAAAGCAAAGAGATGGTCATAAGAAGCAACAAGGCAACTACTAATCAATATTTAAG
GGCAAGTCTAGAGCTGAAATACTCATAGAAGTTAATAGAATTGCACAAGATCTCAGACCA
ATGGGAATTATAAAGGCTATCATTTCGAGTCCTAGCAGAGAGAAGGAACACTTGGTTACT
TTGATCAAAGTTGAAAGTAGCATGGAATTTGATGAAAAAGCACTATAAAATCTAATATCT
CTACACGATCAAAAGAAAAATGCAGTTAGCACAGGAATCTTTGCAGTACCAGTTAGCAAA
AAGCTTCCATGGATGGCTTTGTTTAATATTCCAATAGAACTCATTCAAGATATCAAGAGC
AAAAAGAAAATTAACCAAAGATATTACATAGTCAAGATGATGCCCTGGAAGGCACATGCC
ACTAGACCAGCATGTAATGTGATATCATCAATAGGTGAAGCAGGGAATTTAGATGCTGAA
TCAATGCGTTTACTAAAGATGCACGAGATTTGGTCAGATGAGTATGAAACGGAAGGCCAG
AAAATAAACGAAAAGGTTCATGAATCACTAAGAATCTTCACCAAGGATATTGATGAGAAA
TCAGGAGAATGGATTATTCCACAAGAAGAAATAGCAAGAAGAGTTGATTTGAGAAACAAG
AGAATATTCACAATAGATCCCATTACTGCTAAGGATCTGGATGATGCTTTGTCTATTGAT
AAAATCAGTGATTTCATCTATGAGATTGGTGTTCACATTGCTGATGTCTCTTATTTCGTG
CAATAGGGCACCGAACTTGACAAGGAAGCTTAATTAAGATGTACTTCAGTGTATTTTGTA
CATAAAGTTTACCCTATGCTTCCAAGATTACTGTGCGAGAGACTGTGTTCATTGAATCCA
AAAGTAGACAGACTTGCCTATTCAATATTCTTCAGAATGGATATTAGAACTGGAGAGTTA
GATAAAACATACACACCTAGAATATAGAGAACAGTCATTAAAACATGTGCAAAATGGCAT
TATCAACTTGTCCAGGACATTTTAGATGGAAAGATTTCCCAAGAATCTTAACTAGATGAA
CAATACAAACCAATAAACGGAGTTAAGTTCAGCGAGATGAGAGATGACTGTTTCTTAATG
AATGAGATAGCTCAGAAGAGAAGAAAGAAGCGTCTTGAACACGGTAGTATCTTACTCTCC
AACAGAGAATTTTGTTTTGCTCTAGACCCTGAGACCAAGATGCCCTTCGATTTCTCTGAG
TCTTACAGAATTGAATCGAAATTCTTAGTGGAGGAGTACATGTTGCTGGCTAATATCTTG
ATCGCAGAGCATTTGCATTAATACTGCAAGGACAAGACACTACTGAGAGCTCATCCAGAT
GTTGAAGACGAGAAGAAACTCAAGTTGAAGGTATTCTTTGAGAAAGTGGGTCTGGAATCG
ATTGACTTGACTGACTCACAGACACTCAGTGTCAGCTTAGAGAATTTAAGAGAGACCGGA
GATTCTGCCAAGTTTAATGTAGCTATGAGGAAGTTCTTAACTTGCTTGTAGTGCGCAAAG
TATATGTGTATTAATGATGCCTAGGATCGTGAATATATGCATTTTGGTTTGAATTTCCCA
CTGTACACTCACTTCACTTCTCCAATCAGAAGATATGCAGATCTGTTAGTTCATAGACTA
GTAACATTGACCCTCCAGCACAAAGAAGGAACCAGAGATTTGATAGCATAAATGGACTAC
AGCAACTACGCAGATATGTGCTCAGAGAAGAGTTACAATGCCAAGAGAGCATCACAAGCT
TGTTCAAGATTATTCCACTGCTTGCTGTTGAAGACTAAAGGAGTGAGTGTATTTGAGACT
TTGTTGTTCGATATGGATAATGGTTCAATCAGCATCTATATTGACGAAGTGAACATGCAC
TAGAAGATCAGACTCAGAGATGACTCCCGCATTGAATCACTTGTGTTCTTTGAGGAACAT
CTCACCATAGTCGCCAAGTTAAAGCCAACTAAAGCACAAAAGGAAGAAAACAAGAAGGGT
GGACTCAAGAATGAAGACAAGCTTGATAAGTTCAAGAAAGCAAAGAGCATTCAAGATCTT
CATAATGATTTCGAACCTCATGAAATAATGACCTTACGCATTTTCGACAAAATCAAAGTT
AAGGTAGATACGACTACTGAGTTCCCACTCGATATAGTCTGTACTCTACTTTTCAGTGCA
GAGGATGAAATTGAATATCAGTCAATCCTTAAGTTGACAGAGGAGAAGGCAGAGAAACTT
AGACTAGAGAAACTACAAAAGTCTGTTGTCTAAGAAGTACCAGCTGAGGAGAATCTTAAC
GATGAAGTGTGA


>Contig21538.0.g91(protein)
MSKQYHTEKKATTQGAKISYERAGFVREDKYVLKYVPQEPSYGRGGKNNQRGRPLNDYEE
EEKSSYTNYNDHQPNRQWQNKQQYGNIQSRYQEETMNDDYPYSTTASESKGQNRRGGYQH
HQQQPAMGRARGQNSHQDEGYEQEGLVYHRARFADRGRGRGRGANQHQTQGRDNGFGQPV
DFQETRTRTRGRGRGRGRGHMAPIRDYTNQWVKDDNTYDDQHHHEEEHDSEIFHQSSSSV
ANDEIFQPKYFLNDQRNIEELFEEKCIHDKRSMQQINEYQPKTQAYPKPEFYQGPQYVVY
KQLTSQNRKQRIQSSELFDIQFQNKEKFEQEQQRSHYNANARFEKEREKPQQKFKEVYGQ
TFDFKHEKRTENKFWDNPEGYSKKSRPQKEEKVAGAPARFNRQKGRKGSGGKKGNQKSEA
SKDKFFKKSDGKRGYGDKHQAYEEHLNEEQIQEGIKQGFLFEGILRVNQNNRKRAFVHVN
DIKFDVMVDGLIQQNRGLDGDTVIVQLLEPTRWQKYVSNNVVVGKDSMGSSKLISTISTT
KNRMGYTNETAIETRIIDLETIEQLSPQAQVEEELKEIQEELKQQQRKESSASSDSSDSS
SSKLSHSSEEKQLKKETVESKLDKQDDLEEEEDVGYGMLEDEEVSSESSEEEAKTPKDKK
LQMIKEESSRSAKVERKQKEIVKQRDGHKKQQGNYQSIFKGKSRAEILIEVNRIAQDLRP
MGIIKAIISSPSREKEHLVTLIKVESSMEFDEKALQNLISLHDQKKNAVSTGIFAVPVSK
KLPWMALFNIPIELIQDIKSKKKINQRYYIVKMMPWKAHATRPACNVISSIGEAGNLDAE
SMRLLKMHEIWSDEYETEGQKINEKVHESLRIFTKDIDEKSGEWIIPQEEIARRVDLRNK
RIFTIDPITAKDLDDALSIDKISDFIYEIGVHIADVSYFVQQGTELDKEAQLRCTSVYFV
HKVYPMLPRLLCERLCSLNPKVDRLAYSIFFRMDIRTGELDKTYTPRIQRTVIKTCAKWH
YQLVQDILDGKISQESQLDEQYKPINGVKFSEMRDDCFLMNEIAQKRRKKRLEHGSILLS
NREFCFALDPETKMPFDFSESYRIESKFLVEEYMLLANILIAEHLHQYCKDKTLLRAHPD
VEDEKKLKLKVFFEKVGLESIDLTDSQTLSVSLENLRETGDSAKFNVAMRKFLTCLQCAK
YMCINDAQDREYMHFGLNFPLYTHFTSPIRRYADLLVHRLVTLTLQHKEGTRDLIAQMDY
SNYADMCSEKSYNAKRASQACSRLFHCLLLKTKGVSVFETLLFDMDNGSISIYIDEVNMH
QKIRLRDDSRIESLVFFEEHLTIVAKLKPTKAQKEENKKGGLKNEDKLDKFKKAKSIQDL
HNDFEPHEIMTLRIFDKIKVKVDTTTEFPLDIVCTLLFSAEDEIEYQSILKLTEEKAEKL
RLEKLQKSVVQEVPAEENLNDEV