Identifiers and Description

Gene Model Identifier

Contig22762.0.g47

Standard Name

DIMT1

Aliases

Contig22762_0_g47

Description

Ribosomal RNA adenine dimethylase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00398 ) Ribosomal RNA adenine dimethylase
  • ( pfam13659 ) Methyltransferase domain
  • ( pfam13847 ) Methyltransferase domain
  • ( pfam12847 ) Methyltransferase domain
  • ( pfam08241 ) Methyltransferase domain
  • ( pfam08242 ) Methyltransferase domain
  • ( pfam05175 ) Methyltransferase small domain
  • ( pfam13649 ) Methyltransferase domain
  • ( pfam01135 ) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
  • ( pfam02390 ) Putative methyltransferase
  • ( pfam13489 ) Methyltransferase domain
  • ( pfam01209 ) ubiE/COQ5 methyltransferase family
  • ( pfam01170 ) Putative RNA methylase family UPF0020
  • ( pfam02353 ) Mycolic acid cyclopropane synthetase
  • ( pfam09756 ) DDRGK domain
  • ( pfam03602 ) Conserved hypothetical protein 95
  • ( pfam05219 ) DREV methyltransferase
  • ( pfam05758 ) Ycf1
  • ( pfam10486 ) Phosphoinositide 3-kinase gamma adapter protein p101 subunit
  • ( pfam12569 ) NMDA receptor-regulated protein 1
  • ( pfam04147 ) Nop14-like family
  • ( pfam03153 ) Transcription factor IIA, alpha/beta subunit
  • ( pfam01698 ) Floricaula / Leafy protein
  • ( pfam02724 ) CDC45-like protein
  • ( pfam11705 ) DNA-directed RNA polymerase III subunit Rpc31
  • ( pfam04931 ) DNA polymerase phi
  • ( pfam12722 ) High-temperature-induced dauer-formation protein
  • ( pfam03115 ) Astrovirus capsid protein precursor

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007261209.999242092827953e-100dimethyladenosine transferase
family protein
SGDYPL266W4.998655255837578e-96DIM1 SGDID:S000006187, Chr XVI
from 39121-40077, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22762.0.g47(coding)
ATGGAGAGATAACAAAAGTAATAGAATCATAGAGATTAAAGAGATAAACATAAGGGTCCA
TAAGCTTAGAACCAATTAGCACTTTAGTAATCTGGTCAGATTGGAATGAACTATAACTTT
ACGTTTGATAAGGCATTTGGTCAGCACATTTTGAAGAATCCCTTAGTAGTTCAGTAAATT
ATAGAGAAATCGGGTATTAAACCAACAGATGTAGTGCTCGAAATCGGTCCAGGTACAGGT
AATTTGACTTAATCCCTATTGGAGAGAAGCAAAAAGGTTATCGCAGTAGAAATCGATGCT
CGTATGGTTGCAGAAGTTTCCAAGAGAGTTAATAAATTAGGTTACTAGCATAAGTTTGAG
CTTATCCAGGGTGATGCAATCAAGACACCTTTACCTTTCTTTGATCTGTGTATTGCAAAC
ACTCCTTATCAAATATCATCACCGTTGGTCTTCAAATTGTTACAGCATAGACCTATTTTC
AGATGTGCAGTGCTTATGTTCTAAAGGGAATTCGCTCAGAGACTAATTGCTAAACCAGGC
AGTGATATGTATTGCAGACTCAGTGTGAACGTTTAACTATTGGCAAGAGTCGATCATTTA
ATCAAAGTATCAAAGAACAGTTTTAAGCCACCTCCCAAGGTAGAGTCCTCCGTTGTCAGA
ATTGAACCTAAATTCCCACCTCCTCCAATTAACTTTACTGAGTGGGATGGACTAGTCAGA
TTATGTTTCTTGAGGAAGAACAAGACCATGTCAGGAATCTTTAGATTGAAATAAATTTTG
AAAATGCTGCATAGCAACTATGTTACAATTCATACTCCATAGAAAGCAATTGATAATGGC
AAGAAACAGAATGTCCAGGCATAGGATATAGATTTAACTAGTTTCATGATGGATGAAGCC
AATGCTTTAGCTTTAGGAGGAGTTGATGGTGCTAAATTATCAAAGAAAGACAAGAGAAAG
CTCAAATAGCAAGAACAGCAATAAAAAGCTAAATAACAGAAGGAAGACAGTGATGATGAC
AATGAAGAGATGAAGGAGGATGATATGATTGATGAAGACAAGGAAGATGATGATGAAGAG
CAAATGAATGATGAGGATGATGATGGGGCAGATGATGATAACGATCCATTAAAGTCAATA
AAAGCCTTCAAGAAATTAGTAGTAAAGACATTGGAAGACAACAATATGTAGGATAAGCGT
GCATGCAAAATGGAGATTATAGATTTTCTTAGTCTACTCAGAATATTCAATGAAGCAGGC
ATTCATTTCAAGTGA


>Contig22762.0.g47(protein)
MERQQKQQNHRDQRDKHKGPQAQNQLALQQSGQIGMNYNFTFDKAFGQHILKNPLVVQQI
IEKSGIKPTDVVLEIGPGTGNLTQSLLERSKKVIAVEIDARMVAEVSKRVNKLGYQHKFE
LIQGDAIKTPLPFFDLCIANTPYQISSPLVFKLLQHRPIFRCAVLMFQREFAQRLIAKPG
SDMYCRLSVNVQLLARVDHLIKVSKNSFKPPPKVESSVVRIEPKFPPPPINFTEWDGLVR
LCFLRKNKTMSGIFRLKQILKMLHSNYVTIHTPQKAIDNGKKQNVQAQDIDLTSFMMDEA
NALALGGVDGAKLSKKDKRKLKQQEQQQKAKQQKEDSDDDNEEMKEDDMIDEDKEDDDEE
QMNDEDDDGADDDNDPLKSIKAFKKLVVKTLEDNNMQDKRACKMEIIDFLSLLRIFNEAG
IHFK