Identifiers and Description

Gene Model Identifier

Contig7573.0.0.g78

Standard Name

DIM1b

Aliases

Contig7573_0_0_g78

Description

Mitosis protein DIM1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007942809.998074580622396e-81Mitosis protein DIM1 containin
g protein
SGDYPR082C7.00308173940364e-57DIB1 SGDID:S000006286, Chr XVI
from 704656-704225, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7573.0.0.g78(coding)
ATGTCGTATTTGCTGCCTCACTTGGACAATGGCTGGGAAGTGGACTAAGGTATTTTATCT
GAGGAAGATCGCGTTGTATGCATTAGATTTGGACATGACTGGGACCCAACCTGCATGAAG
ATGGATGAAGTACTCGTTAAGTGTTCTGAAGAGGTTTAAAACTTTGCTGTCATATACTTA
GTTGATATTTCCTCAGTCCCTGATTTCAATACCATGTATGAATTGTATGATCCTTGCACT
GTGATGTTTTTCTTCCGTAACAGGCACATTATGGTTGATTTCGGTACTGGTAACAACAAT
AAATTAAACTGGGCTTTAAGCAATAAATAAGATATGATCGATATCCTTGAGAGTGTCTAT
CGAGGTGCTAGAAAGGGTAAAGGTCTGGTGGTCTCACCCAAGGATTTCTCTACAAACATA
AATAAAATGACAGAATAGACTTAAAATGCATTGACTTCAATTGCGACAGGCTCAATTTTT
AATAAAAGAGCTTAGTCAGTTGCGGGTATAAAGAGAAATAAATTTAAGTTTGAAGTAATA
CAAAAATACAAGCCAAGAATAGTTCAACTTTTGCTTTTATCAAACCAAATATCATTGAAA
TTCAGAGACCTCTTGAGTATGAACCTCCTTAAACAGCCATTAGATCGAAATGGCCAGGTA
TCATACTTTTACTTTTCATTTATTGATATAGCAAATATCAACAATTTCATGCATTTGGCG
AGACAACAGGAAGGAGGCTAAGTTTATGAGAGATCCTTAGATTGGATGTTAACTCTCAGA
ACTTAAACTTAATCTGATTTGTCCACAAGAGAAAAGTAATTATTAAACTAATTTGTAAAT
AATGATGAGTTATTAGGTAAGCTAATTCCAGTGCGCAGCCTCCTTCAGTATATTATAAGA
CAATCTCAACGGATGGCAAAGGTTTTAATATAAGAAAGCTGTCTGTTAAAGATGTCTAAA
TTTAGGGCAATCCTGGTGAAGTTTAACATTTATTTCATAAGAGAATAGGTGAAGCGCCTT
CACAGGGACAGTTAAATTTTGAAACATCTTTGA


>Contig7573.0.0.g78(protein)
MSYLLPHLDNGWEVDQGILSEEDRVVCIRFGHDWDPTCMKMDEVLVKCSEEVQNFAVIYL
VDISSVPDFNTMYELYDPCTVMFFFRNRHIMVDFGTGNNNKLNWALSNKQDMIDILESVY
RGARKGKGLVVSPKDFSTNINKMTEQTQNALTSIATGSIFNKRAQSVAGIKRNKFKFEVI
QKYKPRIVQLLLLSNQISLKFRDLLSMNLLKQPLDRNGQVSYFYFSFIDIANINNFMHLA
RQQEGGQVYERSLDWMLTLRTQTQSDLSTREKQLLNQFVNNDELLGKLIPVRSLLQYIIR
QSQRMAKVLIQESCLLKMSKFRAILVKFNIYFIREQVKRLHRDSQILKHL