Identifiers and Description

Gene Model Identifier

Contig20930.0.g43

Standard Name

DHX37

Aliases

Contig20930_0_g43

Description

Helicase associated domain (HA2)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010447805.001580789778561e-97Helicase associated domain (HA
2)
SGDYGL120C3.9997964105343227e-91PRP43 SGDID:S000003088, Chr VI
I from 283937-281634, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20930.0.g43(coding)
ATGTCTGCAAAAGCTCCCAAACTTTTGAGTAAAGAACTCATGAAGGAACTAGGTGTTACA
AATGCAAAAGACCTAATTTCAAAAAAGAAATCCGTAGATACCAGTGCTAAAAAGCCATCA
GCAAAGCAAAAGGAAAGAGAAAAGAAAAAGCTGCGTAAAGTTCTTGATAAGAAAGCTAAA
CAGGAGAAGATGAAGGATATTTTGTCGTCACTGTAGCAACATAAAGATGATATCAAGGTC
CAGGACTACGATAAGATGCTGAGCACGAAGTTTATGGGGTCAGAGAGAAGAAAGTCATTT
GACGGCAAGCCTAAACCTGAGAAACAAACTGAAGAAGATGTTGATGAAGTTGATATCGAA
CAGGAAGTATAAAAGTAACCAGTTAAACAAGGTATAATTGAGAAGCCTGTAATAGAGCAG
GAAACTAGAGAGAAAGTTGAATAAAACTACGAAGATATGAAGGATATTATCAGGCAAATG
AAGCGTAAACTATAAGAGCAACTAGATTAACAAGCAGATTCTGATGAAGAGGAGAAGAAG
AAACTCAGAGATTTTAATGAAAAGCTCACATTTATTAATAAACAAGATAGAGACCATTTC
CAAGGCAAGAATGTAGTAACTTAAGTAAGGAAAGAGTCAAATGTAATCATGGATGATGTC
AATTATGAGCGTGAAATCATGGAAAGTGTTGAAAATTAGATTGTCACCATAGTGTGTGGA
GAAACAGGAAGTGGTAAATCTACTTAAATACCCTAATTTATTATGAACGCCACAAAACAT
AATCCCTGGAAATATTAAAACAGCGGTGCAACAGGCAAATTGCTTGTTGGTATTACCCAA
CCCAGAAGAGTTGCTGCTGTCAGTTTGGCATAGAGAGTTTCAGACGAAGTCGGTTCTAAA
TTGGGAGACATAGTTGGTTATCAAATCAGGTACGACTCTGAGTTCTTTTCAAGAGAAAAG
ACTTAAATTAAATTCATGACTGATGGTATCCTTCTTAAAGAAATTGAAGCTGACTTCTTG
TTGAAGCACTACTCAGTAATCGTGATTGATGAAGCTCATGAAAGAAGCTTAAACTCAGAT
ATTCTAGTCAGTTTATTAACTAGAATCTCCGAGGCGAGATGCGAGATGGCCTACAAAGAA
AGGAAGGAAGGGAAGTTTGATACACATCCCCTGAGATTGATTATTATGAGTGCCACTCTG
AGAGTTGAGGATTTCAGAGAAAACAAAAGACTATTTCCAAATAAAGAACCCTAAGTTATC
AAAGTGGAGGCAAGACAATTTCCAGTATCCATACATTACAATAAAGTAACCAAGGATGAA
TATGTAGAGGAAGCATATAGGAAGGTAGTCAAGATACATAAAAATTTACCGTAAGGAGGA
ATTTTAGTTTTTGTAACAGGTAAGAAGGAAATTATGTACCTTTGCAAAAGATTGAGTCTT
GAATTAAACAGGAACGCTGGTAGATTAGCAGGTTAGAAGAGATAAAGATCTGAATCTTAA
TAATCTGAAGAGATGTTTGAAGATTATAGCATGTATGCTAATGAAAAGACAGAAGAAGTT
TTAAGAGTTTAAGTTATGCCACTCTATTCATAGTTAAATCCTGATAAGCAGTACAAAGTT
TTCTAAAACCCAAAACCAGGCCATAGATTAATAGTCATTTCAACAAATGTTGCTGAAACT
TCAGTGACAATCCCAAACATAAGATATGTTATAGACTCTGGTAGAGCAAAGGAAAAGGTG
TTTGACAAGAAACTTCAATTATCTTAGTTCAAGGTAGAGTGGATCTCCTAAGCATCAGCT
GAGCAAAGAGCTGGTAGAGCAGGTAGAACTGGTCCTGGTCACTGCTATAGACTATATTCT
AGTGCCCTGTTTTCTAAATTAGATAAATACAGTTAGCCTGAAATAGTGAAAACACCTTTG
GAATAAACTCTTTTACAGTTGAAATCGATGGGAGTTGAGGACTTAATAAGGTTTCCCTAT
GTTACCAAGCCACCCTCCATAGCATTAAAAGCAGCTATTAGGTAGCTCTGTATTCTTGGT
GCTTTAGATATGGATAATTCACAAGCACTTCTGAACCAAACTTCAAATGACATCGATGAG
TATTTATAGTCTGGTAGAGATACTTTTCAATCTTGGAAAAGAGATCCTACAACTATTAAC
TAATTAGGGCTTTTACTTTCAAAAATACCAATATCCCCTAAATTCGGTAAGATGCTTGTA
GTAAGTGCTAAGTATGGCTTGTTAAGATATGCCATTATGATTGTAGCTTGTATGAGTGTA
TCAGAGATCTTTCTCCCTCAAGACTTCAAAGAAACTGAGATAATGGGAGATGATTCAGAA
GATGAAGATAAAAATAGTTTGGGCACCGACAGAGACTTAATTACTTCAATTGACGTTTAA
AAGAAAGAAGCTTAGATGAAGTCTCTTGCCAAGTAAATTAGAGAGAAGAGGATGATGGCT
CTTCATAAAATCAAAGAGCAAAGATCTAGATGGCAAAGTGATAAGAGTGATCTTATAATG
TATGCGAAGCTCATGAGCGATTACTTCACGTTTGTCAATGACAAAAATAATGAGATTATA
GATGCTGAGGACGAATAGCAAAATAAAATATATAAGTACGAATACTTAAGTTATGAGAAG
AAAAGGTATAGATTCTGCCTTGAAAATAAATTGCAGGATAAAGCTATGAAAGAAGTTCAT
TTCTTGTGTCTATAGTTACAGAAAATATTCTTTGACTAGGACTTAGGATTTGAAGAAAAT
AAGAAGTATAACTTAGCTAGTGATAAGATTTCAATGCCAACATCAGAATAAGAATAAGTC
TTGCAATAAATTATAATCAGTGGTCTCTGTGAAAATCTAGCAAGAAAATGCCCAATATTC
GATGCAAATGGCAACGAAATTAAATAAACCAATAAAATGAAGGCAACTTACGAAAGTTAG
GAATCACAAGACAAACTTTCACTGCATCCATTTTCTACATTATATAAAGAAAAACCAGAA
TTTGTGGTTTATCAAGAGATTTATGCTTTACAAAGTCCTGATACTGGTAAAATGAAGTAT
TACCTCAAGGGTGCAACTAAAATTGATAATCTTAATTGGATGTACAATTTATCAAGTCAT
GTTTTATTGCAAACATCCAAGCCAATAACAGAATAGAATAACTCATAGGGCAACTAATTA
GACCTAAAACTTGCCAAGGCCATGATAGCCAAAGAAAAGCAGCAATTAGTTTAATATGAT
GATGCCAAGGATTAAGTTCAAGTATTTGTGAGAGTATTCTATGGTAGTTAGAGATGGCCT
TTAAACATTCAACTGGTTTCTTTGTCAAGTATAAAAGACACTCTCAATCTAGAGGAATAT
TATTCATATTTCGCTTATGCGCTGCTAGAAGGTTTAATATTCCCTAAAATTAAGCAACTC
AAGAAGTATTATGCAGGATCAACAAGAGAAATACTAGAAAAAGGTAATATCAGCTCAAAA
GTTGTCAAAATAGTTGGCTAGTTAAAAATCTAAGACATCGATAGCAAACAAAAGCTTATA
GATAAATGGGGAAATGACAATCCATATTACATGCAGGACTCTATTAATCTTTGGCTTAAT
GAAGAAGGCAAAAAATTACTAAAAAGTAAGTGGCCACCTCTTGATTGA


>Contig20930.0.g43(protein)
MSAKAPKLLSKELMKELGVTNAKDLISKKKSVDTSAKKPSAKQKEREKKKLRKVLDKKAK
QEKMKDILSSLQQHKDDIKVQDYDKMLSTKFMGSERRKSFDGKPKPEKQTEEDVDEVDIE
QEVQKQPVKQGIIEKPVIEQETREKVEQNYEDMKDIIRQMKRKLQEQLDQQADSDEEEKK
KLRDFNEKLTFINKQDRDHFQGKNVVTQVRKESNVIMDDVNYEREIMESVENQIVTIVCG
ETGSGKSTQIPQFIMNATKHNPWKYQNSGATGKLLVGITQPRRVAAVSLAQRVSDEVGSK
LGDIVGYQIRYDSEFFSREKTQIKFMTDGILLKEIEADFLLKHYSVIVIDEAHERSLNSD
ILVSLLTRISEARCEMAYKERKEGKFDTHPLRLIIMSATLRVEDFRENKRLFPNKEPQVI
KVEARQFPVSIHYNKVTKDEYVEEAYRKVVKIHKNLPQGGILVFVTGKKEIMYLCKRLSL
ELNRNAGRLAGQKRQRSESQQSEEMFEDYSMYANEKTEEVLRVQVMPLYSQLNPDKQYKV
FQNPKPGHRLIVISTNVAETSVTIPNIRYVIDSGRAKEKVFDKKLQLSQFKVEWISQASA
EQRAGRAGRTGPGHCYRLYSSALFSKLDKYSQPEIVKTPLEQTLLQLKSMGVEDLIRFPY
VTKPPSIALKAAIRQLCILGALDMDNSQALLNQTSNDIDEYLQSGRDTFQSWKRDPTTIN
QLGLLLSKIPISPKFGKMLVVSAKYGLLRYAIMIVACMSVSEIFLPQDFKETEIMGDDSE
DEDKNSLGTDRDLITSIDVQKKEAQMKSLAKQIREKRMMALHKIKEQRSRWQSDKSDLIM
YAKLMSDYFTFVNDKNNEIIDAEDEQQNKIYKYEYLSYEKKRYRFCLENKLQDKAMKEVH
FLCLQLQKIFFDQDLGFEENKKYNLASDKISMPTSEQEQVLQQIIISGLCENLARKCPIF
DANGNEIKQTNKMKATYESQESQDKLSLHPFSTLYKEKPEFVVYQEIYALQSPDTGKMKY
YLKGATKIDNLNWMYNLSSHVLLQTSKPITEQNNSQGNQLDLKLAKAMIAKEKQQLVQYD
DAKDQVQVFVRVFYGSQRWPLNIQLVSLSSIKDTLNLEEYYSYFAYALLEGLIFPKIKQL
KKYYAGSTREILEKGNISSKVVKIVGQLKIQDIDSKQKLIDKWGNDNPYYMQDSINLWLN
EEGKKLLKSKWPPLD