Identifiers and Description

Gene Model Identifier

Contig13549.0.g40

Standard Name

DHX33d

Aliases

Contig13549_0_g40

Description

Oligonucleotide/oligosaccharide-binding (OB)-fold

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004443109.997093137033517e-262ATP-dependent helicase DHX8, R
NA helicase HRH1
SGDYER013W9.997093137033517e-262PRP22 SGDID:S000000815, Chr V
from 178841-182278, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13549.0.g40(coding)
ATGAGCGAAAGTTTGAAAAAATTGAAAGAAATACCTGTGGTGAACAAGATAATGCAGGAC
ATCGACAGAGCTATCGGCGTGAAAGATAAGGTTTTAGCTGAATTCGTTCTTGATATTGCG
AAGCAATGTCAGAACGTGAGTGAGTTCGAAAGCAAACTTCAGGAGTATGAAGCTGAGTTT
GCGATCGAGTTGGTCAACCAGTTATTTGCCACCATCACCAAAATGCTGCCTGAAAACTTC
AGAAACAACCCCAGTGTGAATAACAAAGATGGTCTAGGTGGCAATGGGATGACCAATTAA
AAAACTGCCAACTTTGAAATTGATCAATTTGGCAATAGAAAGCTACTCTCAGATGAGCCT
GACCAACCTCTCTATGCGTCAAATGTTGGCTTTGGCAAACCGGGCACTGAAGAGTCAAAA
TTCGACTAGTCCGAAGCTTTCGATAGACAATATCTGACCAAACACTACCCCGGTCTGGCT
TTACCAAACTAGCCTCAATTGAAAAATAAGGAAGAAATTGATCTCTTGGAAGATCTAGAC
GCACTAGGTGGCGAAGGGTAGTAGTTAGATACTGATTTAAACAAGGAAGATTTCAAGAAT
AGTAGTAAATATGGGAGAAAGGATGAGAGAAAGAGCTAAGACTCAAGAGATAGAGATCGG
GATAGAAGGTCTTCAAGGCGTCATAGAGACTCACGATCAAGGTCTAACGATAGAGATAGA
AATCGCAGCACTAGGGATAGGGATAGAAAAAGGAGAGACTCAAGATCTCGTTCAAGAGAA
AAAGAAGATACATCTAAAAGAGTAGACCACCGCCACCCCTCAAGAAGGTCCAGATCTAGA
TCTTAGGAAAAGGAAAGAGATGACTCAAGCAGAAGAAACCATCATCACAGATCTCGCAGA
GACTCAAGGTCGAGGTCGAATGATCGCAACAACGACAAAGATCGCGACAGAGACGACAGA
AGGACATTCAGAAAGCCAGATGACAGAAAACTCCCATTTGAGATTGGTGAAATATACAAG
GGTTCAATCAAGAAGACTTAAGACTTTGGATTTTTCGTGTTAATTCAAGATCCTAAGAGT
GGCTACAAAAAGGAAGGCTTGGTTCATGTAAGCTAGATCAAACATGGTGTCAGACTGGAG
AAAGCTATTGATAGCGGATATGAAGATGGTGATGAAGTCTACGTTAAACTGACTTAATTG
AGAGACGATGGTAAACTGAGTTTCTCAATGAAAGAATGCGATTAGTACACGGGAATGGAT
TTAAATCCAGAAAGGTCAAGAACTTTAAAGATGGAAGCCATCTAGAAGTAGAATTAAGGA
GAAGCTGTCCCTGAAGAAGAATATGAAGTCACAGGGGAGATCAATCATAAAGGTGAAGTG
GTTAGAGTCAAGAGACAAATGAACACTCATAAACCAGATGGAATTAAAGTTAGTTAAACT
ACTCATAGTGAAAGTTACGATCCAACCAAGATGTTTGGTTCAATCACAGGCATTCTCTTG
GACACATCAGAGTCAACTAAGGGGAAAAGTGGCAAAAACAGGATTGCCTCCCCTGATCTA
TGGGAGTACACTAGACTACAAGGAGCCAATGTGCTAAACTTGATAGATGACGGTAACATT
CAAAGAATTCAAAATATGAACAACTAAATGGAAGCTAATGAACTAGATGAAGAAGTTGCA
GAGGTTGAGCTTAATGATAAAGAAGCACCATTCTTAAAAGGGTAAACCACTAAAGCTGGA
TTATGTTTATCTCCAATTAAAATTTCTAAGAATCCTGATGGCTCTCTACAAAGAGCAGCC
ATGAAAAGTAGTTAACTTGCCAGAGATAGAAAGGATGTAAGAGAGTAATAATAAAAGGCC
ATTACAGAAGCCTTACCTAAAGATTTGAACAAGATAAGAGATGATCCCACAGCAAACCCA
GCAGTCAGAAATTTAGCTTCAACTTTGAGAAACATTACTCACAATCAATTTGACTTACCA
GATTGGAAGAAAGACACTATGGCCTAGAAACCTCAATAGCAAATAACAGGTTAGGCTTCT
GGTAGATCTCATTTGACAATCAGAGAGTAAAGGGAATCTCTCCCTATCTTCACCTTAAGA
ACTGAACTTATTAAAGCTATCTTTGACAATCGTATTTTGGTAGTTATTGGAGAGACAGGT
TCCGGCAAGACCACTTAAATGCCTTAATACTTAGTTGAAATGGGTCTTTGTACCAAGGGT
AAGAAAGTGGGTTGTACTTAGCCTAGAAGAGTGGCAGCAATGTCTGTAGCAAAACGTGTT
GCTGAAGAAATGAACGTTAGACTTGGCTAGGAAGTTGGTTACTCAATCAGATTCGAAGAT
TATACCTCTCCTAAGACAGTGGTAAAGTATATGACCGACGGGATGTTGCTCAGAGAATGC
CTGATTGACCCAAAACTTAGATCTTACTCAGTTATCATGCTTGATGAAGCTCATGAACGT
ACTATTCATACAGATGTTCTTTTTGGACTGCTTAAGTAAGCCATGGATCAAAGAGACGAT
CTTAAATTGATTGTGACCTCTGCCACACTTGATGCTGAGAAGTTTAGTGCTTACTTCAAC
GACTGCCCTATCTTTAGAATTCCAGGTAGAATTTTCCCAGTAGAGATATTATTCAGCAAG
GATCCTGAGGCTGACTATCTTGAAGCAGCATTAATTACTGTATAACAAATTCACTTGCAA
GAGCCCAGAGGAGACATATTGATGTTCTTAACTGGTTAGGAGGAAATCGATACTTCTTGC
TAGATATTGCATGAGAGAATGAAGGCTTTAGGTGATGATGCTCCAGAACTAATCATTCTT
CCTGTGTATTCAGCACTTCCCTCAGATATGCAATCAAAGATTTTCGATCCAGCACCTTAA
GGATCTCGTAAATGTGTAATTGCTACCAATATAGCTGAAGCTTCTCTAACTATCGATGGT
ATATTCTATGTTGTTGATCCCGGTTTCGCAAAATTGAAAGTTTACAATCCTAAATTAGGA
ATGGACACTCTTATTGTAAGTCCTATTTCTCAAGCCTCAGCTAGACAGAGAGCTGGAAGA
GCAGGAAGAACTGGTCCAGGCAAATGTTTCAGACTATATACCGAAGAAGCTTATAAAAAT
GAAATGCTACCTACTTCAATCCCAGAAATTTAGAGAACAAACTTAGCTAATACAGTGTTG
CTACTCAAAGCTATGGGCATAAACGATTTGATAAACTTTGATTTTATGGATCCTCCTCCT
ATCTAATCCCTTATTGCAGCTATGGAAAGTCTCTATACATTAGGTGCTTTAGATGACGAG
GGATTACTCACAAAGATTGGAAGATTAATGGCTGAGTTTCCACTTGAGCCTTAACTTTCA
AAGATGACTTTGACTTCAGTTGATCTTGGCTGCTCTGATGAGATAATTACTATCGTTGCT
ATGCTGTCAGTTCAAAATGTTTTCTACAGACCAAGAGAAAAGCAAACAGTCGCAGATCAA
AAGAGAGCAAAATTTTATCACCCTGATGGAGACCATTTGACTCTGCTTACAGTTTATGAA
GCCTGGAAAGCTCAAGGTATGTAAAATGCTTGGTGCTTTGAAAATTTCATTCAAGCAAGA
GCCTTGAAAAGAGCATCTGATGTAAGAAAGCAACTAATAACAATTATGGAAAGATTCAAG
CTTCCAGTCATGATGTGCGGCTCATTCACTAACAAAGACTATTCGAAGATAAGAAAGTCC
ATTTGCTCTGGTTTCTTTGTACATGCTTCAAGAAAAGATCCTTAAGAAGGTTATAGAACT
CTTACAGATAACTAACAAGTTTTCATTCACCCAAGTTCCTCACTCTTCAACAAGAATCCT
GAATGGGTTGTGTATCATGAACTAGTTCTAACAACTAAAGAGTACATGAGAGAAGTCTGC
ACAATTGATCCAAAGTGGTTACTAGAAGTCGCTCCAAGTTTCTTCAAAAACGTTAACCCC
AATGAGATGAGCAAAAGAAAGAAAGCTGAGAAAATTGAACCACTGTTTAACAGATACGAG
GACCCACAAGCATGGAGACTTTCAAGAAGAAAGGGTTGA


>Contig13549.0.g40(protein)
MSESLKKLKEIPVVNKIMQDIDRAIGVKDKVLAEFVLDIAKQCQNVSEFESKLQEYEAEF
AIELVNQLFATITKMLPENFRNNPSVNNKDGLGGNGMTNQKTANFEIDQFGNRKLLSDEP
DQPLYASNVGFGKPGTEESKFDQSEAFDRQYLTKHYPGLALPNQPQLKNKEEIDLLEDLD
ALGGEGQQLDTDLNKEDFKNSSKYGRKDERKSQDSRDRDRDRRSSRRHRDSRSRSNDRDR
NRSTRDRDRKRRDSRSRSREKEDTSKRVDHRHPSRRSRSRSQEKERDDSSRRNHHHRSRR
DSRSRSNDRNNDKDRDRDDRRTFRKPDDRKLPFEIGEIYKGSIKKTQDFGFFVLIQDPKS
GYKKEGLVHVSQIKHGVRLEKAIDSGYEDGDEVYVKLTQLRDDGKLSFSMKECDQYTGMD
LNPERSRTLKMEAIQKQNQGEAVPEEEYEVTGEINHKGEVVRVKRQMNTHKPDGIKVSQT
THSESYDPTKMFGSITGILLDTSESTKGKSGKNRIASPDLWEYTRLQGANVLNLIDDGNI
QRIQNMNNQMEANELDEEVAEVELNDKEAPFLKGQTTKAGLCLSPIKISKNPDGSLQRAA
MKSSQLARDRKDVREQQQKAITEALPKDLNKIRDDPTANPAVRNLASTLRNITHNQFDLP
DWKKDTMAQKPQQQITGQASGRSHLTIREQRESLPIFTLRTELIKAIFDNRILVVIGETG
SGKTTQMPQYLVEMGLCTKGKKVGCTQPRRVAAMSVAKRVAEEMNVRLGQEVGYSIRFED
YTSPKTVVKYMTDGMLLRECLIDPKLRSYSVIMLDEAHERTIHTDVLFGLLKQAMDQRDD
LKLIVTSATLDAEKFSAYFNDCPIFRIPGRIFPVEILFSKDPEADYLEAALITVQQIHLQ
EPRGDILMFLTGQEEIDTSCQILHERMKALGDDAPELIILPVYSALPSDMQSKIFDPAPQ
GSRKCVIATNIAEASLTIDGIFYVVDPGFAKLKVYNPKLGMDTLIVSPISQASARQRAGR
AGRTGPGKCFRLYTEEAYKNEMLPTSIPEIQRTNLANTVLLLKAMGINDLINFDFMDPPP
IQSLIAAMESLYTLGALDDEGLLTKIGRLMAEFPLEPQLSKMTLTSVDLGCSDEIITIVA
MLSVQNVFYRPREKQTVADQKRAKFYHPDGDHLTLLTVYEAWKAQGMQNAWCFENFIQAR
ALKRASDVRKQLITIMERFKLPVMMCGSFTNKDYSKIRKSICSGFFVHASRKDPQEGYRT
LTDNQQVFIHPSSSLFNKNPEWVVYHELVLTTKEYMREVCTIDPKWLLEVAPSFFKNVNP
NEMSKRKKAEKIEPLFNRYEDPQAWRLSRRKG