Identifiers and Description

Gene Model Identifier

Contig3639.0.g11

Standard Name

DHX33c

Aliases

Contig3639_0_g11

Description

Oligonucleotide/oligosaccharide-binding (OB)-fold

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004417609.997093137033517e-262RNA helicase, putative
SGDYER013W9.997093137033517e-262PRP22 SGDID:S000000815, Chr V
from 178841-182278, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3639.0.g11(coding)
ATGAATCAATAATTTATAGCAGACTAGCTGCATGAGATCTTGGGTGTTTCCGACGCAGTC
ACAGAGCGCTATATCACTTCCATAGCAAAAACAGCTAAATCGGAAAACGATATATTGGAT
AAATTAATCGATGGCGGACTCCCTGCGAGTCAACAGACTCGATAATTCGCTCACAAGCTC
TTTATGAATGTCACACCAGAGACTAACAAAGCCAAGTTAGTTAATGAATATAAGCAGAAA
GAGTAGCAGATAATCTAATAGAAGATTAAGTAGAATCAATACTCAATGTTGGATGACGAA
GATGAAGAGTCAGATGAAGGCCCGGATAGCAAAGATGACGACTAAAATTAACATTAGCTT
AAATTGTTCTAAGAATTGGAGAAAATTAAAGAGAGAAATAAATAATTAGCTGATGAAGTG
AGAAAGGCTGGAGAGGGTTTACCTCAAGACAAACTATCAAAAAAAGAAGAAAAGGAAATC
AAGAAATTGCAAAAAGAAATGGATAAACTCGAGAGAGACGCCTACGTTGCAAGACTACTA
GAGAAGGATAAAGAGTCGCAAAAAGCTAAAATAGGAAATATAGTGGAAAACCCCTAGAAC
AAACTAGTTACATAAGAAGACAAAAGTTAGCTCATACCTGAACTGAGGAAAATATCCAGA
CAGTAGTATTTAGAGAAGAGAGAAGAGCAGCAACTTGACTTATTCAAGAGACGTTTAGAC
GAGGAGAAGAGACTTTTTAGTGGAGTTGATCTCACAGAATAAGAAAAGAAGATTCAAGCT
TTGAATGAACGATTGTATGATCTCGCCAATAAACGTAGATAAAGAGTAGAGAAAGCTTAA
GTTTATCACATGCCAGATGCTTATGAGGACGATGAAGGTAAGCTTCTCAAAGATAAAAGG
ATGGCTGTTCTAACTAAGAGGTATGAAGAGGAAAAAATGGTACTTACTGAACAGGAGTAA
TGGGAGCTATTTTAATCGAATAAGGCAACTGCACAGTTCGGGGCTAAGATTAAGAAAACC
AAAGAAGAAAAGAACTATGAACTGCTATTGGATAACCAAGTCGACTTTATTCAGACTAAA
GCTATAGAAGGGATCATAGATATAAAATCAAAGCAAAAGAAGAAAAAGAAAACTAAGAAA
TCTAAAACCTCAGATAGTGAAAGTGCTTCTAGCCAAAGCTCAGATGATGAAATGAGTGAT
GCTGAAATTTAAGAAGCTTAAAAATTGCTTACAGCTGAAGAAAAGTAGAGACTAAGTCTA
AAGCAATAAAGAGAGAGTTTACCCATTTATCCATACAGAGATTAGCTACTCGCAGCATTG
AGAGATCATTAAGTTCTGATTATTGTAGGAGAAACTGGTTCTGGTAAAACAACCTAAGTA
CCTCAATATTTACATGAAATTGGTTATACTAAATTTGGTAAAATTGGCATTACATAACCA
AGAAGAGTAGCAGCAATGAGTGTTGCAGCTAGAGTTGCGACTGAAATGAATGTCAAGCTA
GGTCATGAAGTTGGATATTCTATTCGTTTTGAGGATAACACATCAGATAAAACTGTGTTG
AAGTATATGACAGATGGTATGCTGCTAAGAGAGTTTCTAGGAGACCCTAGATTAGATAAT
TATACCTGCTTGATGATTGATGAGGCTCATGAAAGAACTCTGCACACTGATGTTCTCTTT
GGTTTGGTGAAAGATGTCGCAAGAGAAAGAAAAGATCTAAAGCTTTTGATATCATCAGCT
ACTATGGATGCTGAAAAATTCTCTGACTACTTTGATGGAGCCCCAGTCTTTAAATTTCCA
GGAAGAAGGTATCCTGTTGATATGTTTTACACAAAATAGCCAGAAGCTGACTATGTTGAG
GCTTGTGTCATTACAACGCTTTAGATTCATGTCACACAACCACCTGGAGACATATTGGTA
TTTTTAACAGGTCAAGAAGAAATTGAGACTGCCTAAGAAATGCTGTAGTAAAGAACTAGA
GGACTAGGAACCAAAATATCAGAGCTTGTTATTTGCCCAATTTATTCAACTTTACCATCC
GATATGCAAGCAAAAATCTTTGAGCCAACTCCTGGTAACGCAAGAAAAGTGGTTTTAGCA
ACAAATATAGCAGAGACTTCTCTGACTATAGATGGTATTATTTATGTGATTGACTGTGGC
TTTGCAAAATAAACTAGTTATAATCCAAGGACTGGAATGGAAAGTTTGATTGTAACACCA
ATTTCTAAAGCATCTGCTAATCAAAGAGCAGGAAGAGCAGGTAGAGTAGCTCCTGGTAAA
TGCTTTAGACTTTATACTGCTTGGTCATTTTAAAATGAACTTGATGATGCAACTATTCCA
GAAATTTAAAGAACTAATTTAGGTAACGTAGTATTGATGTTGAAAAGTCTTGGTATTAAT
GATTTGATACATTTTGATTTCATGGATCCTCCTCCTGCAGAAACTTTGATTAGAGCTTTA
GAGCAACTTTATGCCTTAGGAGCTTTAAATGACGAGGGTGATCTCACTAAATTAGGAAGA
AGAATGGCTGAGTTTCCCCTCGACCCTATGCTCTCCAAATGCCTCATACAAGCTGAGACA
TATAAATGTGTTGACTAGATTATTACTATTTGTGCAATGTCCTCTGTTGGAAACTCTATA
TTCTTTAGACCTAAGGAGAAAGCTCTGCATGCTGATAATGCAAGGAAAAATTTCTTTAGG
CCTGGAGGCGATCATATTTGTTTACTTAACGTTTTTGAATCTTGGAAAGAAACGAACTAC
TCAACTTAATGGTGCTTCGAGAATTTTATTCAAGTCAGGTCTATGAAGAGAGCAAGAGAT
ATCAAAGAGCAGTTAATTGAACTTTGCAAAAGAGTGGAAATTGATTATACTAACGAGAAG
CTGTCGGTAATTGATGATGATGTTTATAGTAATGTTAGAAAGGCTATAGCATCTGGTTTC
TTCTATAATACAGCAAAGTTACAAAAATCAGGGAACTACAAGACTCTTAAAAATCAACAT
ACTGTGCATATTCACCCAAGCAGCTGTATGTTTGAAGCTTTGCCTAAGTGGGTAATATAT
CATGAATTGGTGTTTACGACTAAGGAGTTTATGAGAAACGTAATTGAGTTAAATCCAGAT
TGGCTACTTGAAATAGCACCTCACTACTACAAGAAATCTGATTTGGAAGATAACGAAGAC
AAGAAAAAGAAAAATGTTAAACTCCCACCCCAAGCCAAAAAGTGA


>Contig3639.0.g11(protein)
MNQQFIADQLHEILGVSDAVTERYITSIAKTAKSENDILDKLIDGGLPASQQTRQFAHKL
FMNVTPETNKAKLVNEYKQKEQQIIQQKIKQNQYSMLDDEDEESDEGPDSKDDDQNQHQL
KLFQELEKIKERNKQLADEVRKAGEGLPQDKLSKKEEKEIKKLQKEMDKLERDAYVARLL
EKDKESQKAKIGNIVENPQNKLVTQEDKSQLIPELRKISRQQYLEKREEQQLDLFKRRLD
EEKRLFSGVDLTEQEKKIQALNERLYDLANKRRQRVEKAQVYHMPDAYEDDEGKLLKDKR
MAVLTKRYEEEKMVLTEQEQWELFQSNKATAQFGAKIKKTKEEKNYELLLDNQVDFIQTK
AIEGIIDIKSKQKKKKKTKKSKTSDSESASSQSSDDEMSDAEIQEAQKLLTAEEKQRLSL
KQQRESLPIYPYRDQLLAALRDHQVLIIVGETGSGKTTQVPQYLHEIGYTKFGKIGITQP
RRVAAMSVAARVATEMNVKLGHEVGYSIRFEDNTSDKTVLKYMTDGMLLREFLGDPRLDN
YTCLMIDEAHERTLHTDVLFGLVKDVARERKDLKLLISSATMDAEKFSDYFDGAPVFKFP
GRRYPVDMFYTKQPEADYVEACVITTLQIHVTQPPGDILVFLTGQEEIETAQEMLQQRTR
GLGTKISELVICPIYSTLPSDMQAKIFEPTPGNARKVVLATNIAETSLTIDGIIYVIDCG
FAKQTSYNPRTGMESLIVTPISKASANQRAGRAGRVAPGKCFRLYTAWSFQNELDDATIP
EIQRTNLGNVVLMLKSLGINDLIHFDFMDPPPAETLIRALEQLYALGALNDEGDLTKLGR
RMAEFPLDPMLSKCLIQAETYKCVDQIITICAMSSVGNSIFFRPKEKALHADNARKNFFR
PGGDHICLLNVFESWKETNYSTQWCFENFIQVRSMKRARDIKEQLIELCKRVEIDYTNEK
LSVIDDDVYSNVRKAIASGFFYNTAKLQKSGNYKTLKNQHTVHIHPSSCMFEALPKWVIY
HELVFTTKEFMRNVIELNPDWLLEIAPHYYKKSDLEDNEDKKKKNVKLPPQAKK