Identifiers and Description

Gene Model Identifier

Contig18937.0.g110

Standard Name

DHX33b

Aliases

Contig18937_0_g110

Description

Helicase associated domain (HA2)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003725009.997093137033517e-262hypothetical protein
SGDYKR086W9.997093137033517e-262PRP16 SGDID:S000001794, Chr XI
from 599857-603072, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18937.0.g110(coding)
ATGAAAGATAATAACAAACGGAGATCAAGATCAAGGTCTAATAAAAGAAAGGATAAGAAG
TCATCTTCATCTAGACATGATTCTGAAAGATAAGAACGCAGCAGGGATGACCACTATCAA
AAGCACAGTGATAGTGGTAATAGACGGGATAGAGATAGAAATGATAGATATTCTGAGGGC
AGTAGTAGCAGACATGGAAGTAGTTCCAGCAGGAGAGACACCAACAATAGAGACAGGGAT
GATAAGAGAAAGCAAACTGGCTCAACAATGGTGAGTGGCGGCATGACTCCATTATTTTTC
AAAGGTTCAGAAGGCGCCACCTTAAAACCATTTGTACCTACTACTACAAGAGCCTCACAG
AAAAATTCTGATACTTTAACATCCGCACTATTCAACGAGTCATCTAATAGGTCTTCTACT
AATGCTCAATTGGCTGTTTAGGATGAGTCTAAAATGAGTAGAGTGGACCTCTCAAACTCT
AAAGGTCAAGAGGAATTTGCGTTTATGAAATACTCAGATGATTTCACTGCATTAGATTGG
GAGTAAAAAGAACAAATGGAGAAGCAAATGGACAGAGCATGGTACGATGCCGATGAAGAT
TCCAATATCAGATATGGCACTGATGCCTTCGATGGTGACTTCATGGGAGGAGTCTCAGCC
GAAGAGGAGAAGAAGGCCAATGAAGAGTTGTTAAGAAAGAAGAAACAAATGAGCTAGCCT
ATATCAAGAAGAAGCTTAAATTCTGCTGATCATGACAAGTGGGAGATGGATAGAATGCTC
AGATCAGGAGCTGTAGAAATGAAGGACAATTTTAGAGCAGGGGATATGCTAATGGAAACA
GACGAAGAAAGAGTCATTCTCATAGTTCACGATATGAAGCCACCCTTCCTTGATGGTAGA
ATAGTTTTTACTACACAAACTGAGCCAATTTAAGTGGTTAAGGATGTGACTGGCGATTTC
TATTAAGTCTCAAAGAAGGGTAGTTAGGTCCTCAGAATGATAAGAGAGGTTTAAAACAGA
GAATCTATGAGAGAGAAATTCTGGGAGTTAAGTGAGAAGACCAGACTTGGAAGTTTGTTG
AAGATGGGTAGAGATTAGGATAAATTGGAGAATTCTAATGCACCAGGACTTGGCAAAAAG
ATATTGGAGAATGTCAATCAGATTCAAAATAAGACTCAGGATGAAGAAGTTGATTACAAA
ACTGAGAGTTAGTATGGAGCATCTATGAAAGTCAAGAATGAAGCTGTGAGTGACTTCGCA
AAATCCAAAACACTTAAAGAGCAACGTGAATATCTCCCAGTCTATTCTGTAAGGGATGAA
CTTTTGACTGTAATTCGTGACAACAAAATCGTAGTCATAGTAGGTGAGACTGGAAGTGGC
AAGACCACTCAACTGACTCAATATCTGCACGAAGATGGTTACTCTAAGGAAGGTATTATT
GGATGTACTCAACCTAGGAGAGTTGCTGCTGTTAGCGTTGCGAAGAGAGTCGCAGAAGAA
ATGGGAGTTGAATTGGGCAGCAAAGTAGGCTACTCAATCAGATTTGAGGATTGTACTTCC
AAAGAAACTGTCATCAAGTATATGACAGATGGAGTGCTATTGAGAGAATCTCTAATTGAC
TCAGAGCTTAATCAATATAGTGCTATTGTCATGGATGAAGCTCATGAAAGATCTCTCAAT
ACAGATGTCCTTTTTGGTATCTTGAAAAAGGTGGCTCAGCAGAGAAGAGACATTAAATTA
ATCATTACATCAGCAACCATGAATGCTGAAAAGTTCGCAGAGTTTTTTGGCTAGGTGCCA
ATTTTTATTATCCCTGGTAGAACTTTCCCAGTCTAGTAATATTTTTCTAAAGCTATTCAA
GAAGATTATGTTGATGCAGCAGTAAAATAAGCATTGACTATTCATTTGCAAAATGGGCCT
GGAGACATATTGATATTTATGACAGGATAAGAGGATATAGAAGCTACTTGCTATTTAATT
GCTGAAAGGCTTGGAAAGCTTGAAGGAGTGACTCCAATGTTAGTTTTACCAATCTATTCT
CAATTACCCAGTGATGTCTAAGCAAAAATCTTCGAAGCCAGTGAATTCAGAAAATGCATT
GTAGCTACAAATATTGCAGAAACTAGTCTGACTCTCGATGGAGTGAAGTTCGTCATCGAT
ACTGGCTTAAGCAAGTTGAAAGTTTACAATCCAAAAATAGGAATGGATGCACTTTAGATC
ACACCAATTTCTTAAGCAAATGCTAATCAGAGATCCGGTAGAGCAGGTCGTACAGGGCCA
GGTATATGCTATAGGATGTACACTGATACAGTCTATAGAAATGAGTTCCTAGAAAATAAT
ATCCCAGAGATATAGAGAACTAATTTGTCAAATGTTGTCCTTTTACTTAAGTCTCTTAAT
GTTGAGAATCTTTTAGAGTTTGACTTTATGGATCCACCTCCACAAGATAATATCATGAAT
AGTATGTATCAATTGTGGATCTTAGGAGCACTTGATAATACTGGTAATTTGGCAGAACTT
GGAAGAAAAATGGTTGAATTCCCACTGGATCCTCCTTTGAGTAAAATGCTTATTATGAGT
GAAAAGTTTGGCTGCAGTTAAGAAGTTCTTACTATCGTCAGTATGCTATCAGTTCCAAGT
ATTTTCTTCAGGCCTAAGGGTAGAGAACAAGAGTCTGATGCAGCCAGAGAAAAGTTCTTT
GTTCCTGAATCTGATCATCTCACACTCTTGCATGTGTATGATCAATGGAAAATGAATAAT
TACGATTAAGAATGGGCAACTAGACACTTCGTACATGGTAAAGCTTTAAAGAAGGTCAGA
GAGGTCAGATCTCAACTTCTAGACATCATGAAGCAACTAAAAATGGACATGAATAGTGTT
GGTACCGATTGGGATCAAATTAGAAAGGCTATATGTTCTGGTTATTTCCACAATGCTGCT
AAAATTAAGGGTATTGGTGAGTATGTAAATCTAAGAACAGGTATACCTTGTGTTTTACAT
CCATCAAGTGCTATCTACGGTCTTGGATTCACTCCAGACTATGTCGTTTATCACGAGTTA
GTCATGACTACTAAAGAATATATGCAGTGCGTTACCGCAGTCGATCCTCATTGGCTTGCT
GAACTAGGACCAATGTTTTTCTCAGTCAAGGAGGCTTACGGTTAGAGCAATCTTTCTAAG
CATGATATTGAGAGACAAGGTAAATCTCAGATGGAATAAGAGATGCAAGCTGAATTAAGA
AGAAAAACTCAAGAATTGCAGAAATAATCTATGACCACTTAGATCAATAGAAAGTCTACA
GGAATGAGATTTGGATCAGGAGGAAGTTTATAAACTGAAATTATTTATCCAGGTATGGGA
AAACCTGGTTTATTAACTGGTTCTTAAACTCAACCAAGATCAAAGCCTATGCTAACTCCA
AGAATTGATCCAAGCAGAAAATATGATTGA


>Contig18937.0.g110(protein)
MKDNNKRRSRSRSNKRKDKKSSSSRHDSERQERSRDDHYQKHSDSGNRRDRDRNDRYSEG
SSSRHGSSSSRRDTNNRDRDDKRKQTGSTMVSGGMTPLFFKGSEGATLKPFVPTTTRASQ
KNSDTLTSALFNESSNRSSTNAQLAVQDESKMSRVDLSNSKGQEEFAFMKYSDDFTALDW
EQKEQMEKQMDRAWYDADEDSNIRYGTDAFDGDFMGGVSAEEEKKANEELLRKKKQMSQP
ISRRSLNSADHDKWEMDRMLRSGAVEMKDNFRAGDMLMETDEERVILIVHDMKPPFLDGR
IVFTTQTEPIQVVKDVTGDFYQVSKKGSQVLRMIREVQNRESMREKFWELSEKTRLGSLL
KMGRDQDKLENSNAPGLGKKILENVNQIQNKTQDEEVDYKTESQYGASMKVKNEAVSDFA
KSKTLKEQREYLPVYSVRDELLTVIRDNKIVVIVGETGSGKTTQLTQYLHEDGYSKEGII
GCTQPRRVAAVSVAKRVAEEMGVELGSKVGYSIRFEDCTSKETVIKYMTDGVLLRESLID
SELNQYSAIVMDEAHERSLNTDVLFGILKKVAQQRRDIKLIITSATMNAEKFAEFFGQVP
IFIIPGRTFPVQQYFSKAIQEDYVDAAVKQALTIHLQNGPGDILIFMTGQEDIEATCYLI
AERLGKLEGVTPMLVLPIYSQLPSDVQAKIFEASEFRKCIVATNIAETSLTLDGVKFVID
TGLSKLKVYNPKIGMDALQITPISQANANQRSGRAGRTGPGICYRMYTDTVYRNEFLENN
IPEIQRTNLSNVVLLLKSLNVENLLEFDFMDPPPQDNIMNSMYQLWILGALDNTGNLAEL
GRKMVEFPLDPPLSKMLIMSEKFGCSQEVLTIVSMLSVPSIFFRPKGREQESDAAREKFF
VPESDHLTLLHVYDQWKMNNYDQEWATRHFVHGKALKKVREVRSQLLDIMKQLKMDMNSV
GTDWDQIRKAICSGYFHNAAKIKGIGEYVNLRTGIPCVLHPSSAIYGLGFTPDYVVYHEL
VMTTKEYMQCVTAVDPHWLAELGPMFFSVKEAYGQSNLSKHDIERQGKSQMEQEMQAELR
RKTQELQKQSMTTQINRKSTGMRFGSGGSLQTEIIYPGMGKPGLLTGSQTQPRSKPMLTP
RIDPSRKYD