Identifiers and Description

Gene Model Identifier

Contig12082.0.g38

Standard Name

DHX33a

Aliases

Contig12082_0_g38

Description

Helicase associated domain (HA2)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010447809.997093137033517e-262Helicase associated domain (HA
2)
SGDYGL120C9.997093137033517e-262PRP43 SGDID:S000003088, Chr VI
I from 283937-281634, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12082.0.g38(coding)
ATGAGTAGCAAGAAACTTAATCAAGAAGAAGAAGTTTTCAAGAAAAACAAGAGATTCTCT
ATAAATCCAAAAGAAAAGTAGGAAGAAGATACAATGAGTAAAACTTCAAGCGGAACAAAA
GCATCCTCTTCAAAGGATAGTAGTAGATCAGGCTTGAAAAGATCTCACCCTACTTCAATC
GGGACAGACTCTTCGGGTAGTGACAGTGATAGCAGCAGTTCCAGCTCCAGTTCTAATTCA
AGTGAAGATAAAAAATCAAAGCATTCGTCAACTTCATCAAAGAAGTCAAGTAATCATAAG
CAATTAGAGCCTGAGATTAAGAGATAGCATATTGATAGACCATAAGATCACTTCGATTAG
CATCCACATACAAACCCATTTACTAACAGACCATTCTCTCCATAATATTACAAGATTTTA
GAGAAGAGAAAGGAATTGCCAGCATGGGAAGCTAGACATAAAGTAGTAGAGTTAGTTAAG
GAGTATTAAGTTCTTGTTTTACAGGGAGAGACAGGTAGTGGTAAAACTACCTAAGTGCCA
CAGTTTTTACTTCTTGCAGGTATTGCTAAGGGAAAAATTATTGCATGTACCCAACCAAGA
AGAGTGGCAGCTATGAGTGTAGCCAAGCGTGTTAGTGAAGAAATGGATGTCACTTTAGGT
CAAGAAGTAGGATATACAATCAGATTTGAAGATAGATCATCTCAAAAGACAGTGTTGAAG
TATTTGACTGATGGTATGCTTCTAAGAGAAGCCATGAGTGATCCAATGCTATCTAGATAT
GGAGCTGTTATACTCGATGAGGCTCATGAGCGTACTCTGTCCACAGATATTTTGTTTGGA
TTAATCAAGGATGTTTTGACAAGAAGGAAAGACTTAAAAGTTGTTGTTATGAGCGCCACA
CTTAATGCTGAAAGGTTCCAGGAATATTTTGAGGGAGCTCCTCTGCTTGATGTTCCAGGT
AGAATGTATCCAGTCGAGATCTTCTATACACCCGAGCCTGAAAAGGATTATTTGATTGCT
GCTATTAGAACAGTTCTATAGATTCACGTTACAGAAGATCAAGGTGATATTTTACTTTTC
TTAACAGGAGAAGAAGAAATCGAGCAATCTTGCAGAGAAATTCGTGATGAATGCAAAAAA
TTGGGAGATGAAGTCGGAGATATGCTAGTAGTACCACTTTATTCTTCCCTTCCACCAAAC
CAGTAACAAAGAATTTTTGATGTTGCTCCACCAAAGAACAGAAGAGGAATTCCAGGTCGT
AAATGCGTTGTCTCAACAAACGTTGCTGAAACTTCACTTACCATTGATGGTATTGTTTAT
GTGATAGATCCAGGTTTTGCTAAACAAAAAATGTACAACCCCAGATTAAGAGTAGAATCA
CTTTTAGTATCACCTATTTCTAAAGCTAGTGCTAAGCAAAGAGCAGGTAGAGCTGGAAGA
ACAAGACCAGGAAAATGTTTCAGACTTTATCCCGAAAGAGCATTTGAAAAGGAATTGAAA
GAAAACACATACCCTGAAATCCTTAGATCTAATCTTAATTCAGTCGTGCTTACCCTATTG
AAACTTGGAATCAAGGATATTGTACATTTTGACTATATGGACCCACCCGCCCCAGAAACA
TTAATGAGAGCACTAGAAGAGCTTAACTACCTTGGAGCTTTGACTGATGACTGCTAATTA
ACTTAAGTTGGTCAAAGAATGAGTGAATTCCCTCTCGACCCACAGATGTCTAAAGTCATA
ATTGAGGCTGAAAGACTCTAATGTGTGAATGAAGCAGTATCAATAGTAGCAATGCTTAAT
GTTCCAGTGATCTTCCTTAGACCAAAAGAGTGCCAAAACGAAGCAGATGCCGCAAAGAGC
AGATTCTCACATGAAGACGGTGATCACTTGACTATGTTAAATGTGTTCAACGCCTATAAG
TTAAAGAAAGAGAATCCAGACTGGTGCTATGATCATTTCTTAAACTTCAGAGCTCTCAAG
CAAGCTAATGATGTTAGAGATTAACTACTTTAGATAATGATTAAATTGGGACTTAGAGTT
AACAGCAGACCCATGAATGATCCTGAATATTACACAAACATTAAGAAATCATTATTATCA
GGCTACTTCATGCAAGTTGCTCATCTCCAACGTGCAGGTCACTACCTGACTTTCAGAGAC
GACTAAGTAGTAGCTATGCATCCCTCCACTGCTTTAGACCACAAGCCAGAGTGGTGCATG
TACAATGAATTCGTGCTCACTTCCAAGAATTACATAAGAACTGTGACTGAGATTTAGCCA
GAGTGGTTGTTCGATATTGCACCAGAATACTTTGAGCTATCTGAAATTAAGAACAGTGAA
GCTAAGAGGAAATTAGAGAGAGTTTACAAGAGATATTAAGAAAACTAGAAATAATGA


>Contig12082.0.g38(protein)
MSSKKLNQEEEVFKKNKRFSINPKEKQEEDTMSKTSSGTKASSSKDSSRSGLKRSHPTSI
GTDSSGSDSDSSSSSSSSNSSEDKKSKHSSTSSKKSSNHKQLEPEIKRQHIDRPQDHFDQ
HPHTNPFTNRPFSPQYYKILEKRKELPAWEARHKVVELVKEYQVLVLQGETGSGKTTQVP
QFLLLAGIAKGKIIACTQPRRVAAMSVAKRVSEEMDVTLGQEVGYTIRFEDRSSQKTVLK
YLTDGMLLREAMSDPMLSRYGAVILDEAHERTLSTDILFGLIKDVLTRRKDLKVVVMSAT
LNAERFQEYFEGAPLLDVPGRMYPVEIFYTPEPEKDYLIAAIRTVLQIHVTEDQGDILLF
LTGEEEIEQSCREIRDECKKLGDEVGDMLVVPLYSSLPPNQQQRIFDVAPPKNRRGIPGR
KCVVSTNVAETSLTIDGIVYVIDPGFAKQKMYNPRLRVESLLVSPISKASAKQRAGRAGR
TRPGKCFRLYPERAFEKELKENTYPEILRSNLNSVVLTLLKLGIKDIVHFDYMDPPAPET
LMRALEELNYLGALTDDCQLTQVGQRMSEFPLDPQMSKVIIEAERLQCVNEAVSIVAMLN
VPVIFLRPKECQNEADAAKSRFSHEDGDHLTMLNVFNAYKLKKENPDWCYDHFLNFRALK
QANDVRDQLLQIMIKLGLRVNSRPMNDPEYYTNIKKSLLSGYFMQVAHLQRAGHYLTFRD
DQVVAMHPSTALDHKPEWCMYNEFVLTSKNYIRTVTEIQPEWLFDIAPEYFELSEIKNSE
AKRKLERVYKRYQENQKQ