Identifiers and Description

Gene Model Identifier

Contig16662.0.g67

Standard Name

DGCR14

Aliases

Contig16662_0_g67

Description

Nuclear protein Es2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004864500.00008003872323201264hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16662.0.g67(coding)
ATGGAAGTAGCGACAACAATAACCAAGCCTAATAAACCTGCTAAACAAGAATAAAAACAA
CTAACTCTTCACACTTCATCCTCTAAAACCTTAAAGCCATTTTCCTAGGTATAATCTCTC
CTATTGACTACTTAAGATAAAATGAACATGCTTTAAACTTACATACCTAACTAGAATTCA
ACATACGTAAGACCATAAGTTCACAAAGCCAAGCAAACAATACTTGAAGAGGATGATTAC
TATTAATATCTTGAAGAGATTATAAAAAGGGATTTCTTTCCAGATCTTATCAAAATGGAG
GCTTATAAGGAATATATTCAAAGTGAATAGGATAGAGCGAGATAAGAAGCTATGGGAAAA
GGTAGAAATAACTTAAACACAGGGACAACAATGCAAAGTTAGAAACAAGGAGCAGGTTTT
CGAAATGTACCCAGTGTATTGTTAAAAGAAACACCTTTAGATAAGGATATTTTTGATAGG
CGAGATCCCTTGGATAAGATATTGGATAACAGAAAGTGTAAAAGTAATTAATCTGTACTA
GGTAAAAGAGGGCAGCATGAATTTGAATCTGACTTTGGAGATCATGAACTGGATGAGTTG
CTAAGAAATTAAAAAGATTCTCAGAAGAAACTTGATGTCTCTAAAATAGGCTTAGACGAG
TACCTAAGAAGATACACTTCATAAGATAATTAAGCTTTTGTGGAACTACATCAGAAAGAC
AGGCAGTTGTTTCTAAACAAATTAGCTTGGATGTTCAATGATCATGATAAATACTCCTAA
CTTAACTAATTATCTATTGAAAATGGTCGAACTAATAATTAATCTCTTGCTCTGCTAAGT
GAGGCTTAAAGTCTAAACGAGGCAAATAGACATAATTCAAAAACTATACCTGCTCTTTAA
TTCGGTGAACATTAAATTTAATCCCAGTTCTTTTTCAGAGCTCCAGGTGAAGATTTAGGA
GCTGTATATGATAACTAAGTTTAAATCAGATAAAATTTACAGGACTTGAATGAACAAAAT
TTGACTTACAAAAATTCAGATTAAATCAAGTTAAGTAATACAAGACTCCCTTCAAAGTTT
TTGGCTGATTAATTAGAAAAAGATGAGTAGATCTAAAGAGAAAAGCTTCAAAAAGCCTAA
GAAAAAACAGCGGGTGTTTACCATAACAATCAGAGATATAGAAAGTCTTAAGGAGATAAC
AATTAAATATAGAATATACCAATCGACAAACTCTAAGACTTTGATAAACCCATAAGTAAG
GATCTTTTAAATGGACTCTTCTAGAAGCCATTTGATAAGTAAAATCCTAACAATCCTGAA
GGCGAAAATCAAATAGAATTAGGCCAGATGATTGCAATTAACCGTGGACTCTTGAATAAA
GAATAAGTGCTAAACTCAAAGAACAAAGTTGAGTAGACACCAATGATTAAAGGATATAAA
CTTATTAAAGCATCCCCTCTACATCCCAATGCAAAGCCAAATTATAACTAATAGAATAAC
AGTGGAAATTAAAGAGTTGCTGTTGATGAGTCTCCCATGATTACTTGGGGTAAAATTGAA
GGTGAACCATTGTTTTTGGGTCACAATACAAAATAAGCTTAATAAAAATAGTAGTATGCA
ATCCCAGAGAGTCCATTAAGAGATGACTTAGGAATAAAAATGGCAAATAAAACTCAAGTG
AAAAAACGTGAAGAAAAAGCAAAAGAAAAATCAGATATAATGAGAAAACTCAATACTTCA
ACTAAAAACACTCCACTTGTGATTCAACAGCAAGCTCTATCTGATAAAGCGAAGGAGCTT
TTGAACTCAATTAAGAGAAGCAGTAATGTATTGCAAAATCAAAATAAAATGAGAAGTGAT
ATTAGAACCCCGCTTATTAAGAGATGA


>Contig16662.0.g67(protein)
MEVATTITKPNKPAKQEQKQLTLHTSSSKTLKPFSQVQSLLLTTQDKMNMLQTYIPNQNS
TYVRPQVHKAKQTILEEDDYYQYLEEIIKRDFFPDLIKMEAYKEYIQSEQDRARQEAMGK
GRNNLNTGTTMQSQKQGAGFRNVPSVLLKETPLDKDIFDRRDPLDKILDNRKCKSNQSVL
GKRGQHEFESDFGDHELDELLRNQKDSQKKLDVSKIGLDEYLRRYTSQDNQAFVELHQKD
RQLFLNKLAWMFNDHDKYSQLNQLSIENGRTNNQSLALLSEAQSLNEANRHNSKTIPALQ
FGEHQIQSQFFFRAPGEDLGAVYDNQVQIRQNLQDLNEQNLTYKNSDQIKLSNTRLPSKF
LADQLEKDEQIQREKLQKAQEKTAGVYHNNQRYRKSQGDNNQIQNIPIDKLQDFDKPISK
DLLNGLFQKPFDKQNPNNPEGENQIELGQMIAINRGLLNKEQVLNSKNKVEQTPMIKGYK
LIKASPLHPNAKPNYNQQNNSGNQRVAVDESPMITWGKIEGEPLFLGHNTKQAQQKQQYA
IPESPLRDDLGIKMANKTQVKKREEKAKEKSDIMRKLNTSTKNTPLVIQQQALSDKAKEL
LNSIKRSSNVLQNQNKMRSDIRTPLIKR