Identifiers and Description

Gene Model Identifier

Contig3448.0.g39

Standard Name

DGB4

Aliases

Contig3448_0_g39

Description

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam13589 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam02518 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam02287 ) Dehydratase small subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011099400.00007000107212225429DNA mismatch repair protein, C
-terminal domai...
SGDYNL082W0.00020003864201578029PMS1 SGDID:S000005026, Chr XIV
from 473391-476012, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3448.0.g39(coding)
ATGTACTTGATTGGTAAAAGCTCAAGCAGGCCAAACATAAAAAGAAAGTATCAATATCAT
AAAACAGATCCTTCTACTGTGCCTTCGGAGAAAAAAGATAGGCCATCAGATGGAATGAAA
TAGATGCTTTTGAAACCCCTAGAACCTAAGCCAACAAACCTAGAAATGGTAAAAAAAGCA
GGAGAGTTAATTTAAGTTTCAGATATTAGAATTCATGACATTTACTAACTTTTGCGAATT
TGGATAAGCTAACTTGTAGAAAATTCTGTAGAAAGAAATGCTAAGAAAATTGAGGTTAGG
CTTTATGATTAAGGCAAGTTAGGATTCGACATTATCGATGATGGAGAGGGAATAGAAGAA
CAAGAATTTGATAACGATTATGTTAAATGCATGCCAATGAGAGCAAGGAATGAAATTTAC
AAAACTTGA


>Contig3448.0.g39(protein)
MYLIGKSSSRPNIKRKYQYHKTDPSTVPSEKKDRPSDGMKQMLLKPLEPKPTNLEMVKKA
GELIQVSDIRIHDIYQLLRIWISQLVENSVERNAKKIEVRLYDQGKLGFDIIDDGEGIEE
QEFDNDYVKCMPMRARNEIYKT