Identifiers and Description

Gene Model Identifier

Contig17564.0.g86

Standard Name

DGB3

Aliases

Contig17564_0_g86

Description

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam13589 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam01119 ) DNA mismatch repair protein, C-terminal domain
  • ( pfam04690 ) YABBY protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL082W0.000000005997038937208364PMS1 SGDID:S000005026, Chr XIV
from 473391-476012, Geno...
T. thermophilaTTHERM_011099400.000000600201742947405DNA mismatch repair protein, C
-terminal domai...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17564.0.g86(coding)
ATGATTAAACTTAAAACTAAAGTGATCTTTATCATGAAAGCCAAAATAAACAAAGATATG
GGAGTTTTGGGCTTTGACGTGATAGATAATGGTATAGGAATTTAAGAATCAGAATTTGAT
GATAATTATTTGAGGTGCATGCCATAGAGGGAAAGAAATGAAATTTATAAATCTCGAAGT
ATAGGATATAAGGGTGAGGCACTAGATTGCTTAGCTAGACTTGGAAAACTTACCATTCTT
TCTAAATTTGCAAACAAAAACTTGACATAAGTTGTAAGCTTTAATAAAATGAGGCAGGTT
GAACAAAGTTCATACATTAATAAATGCTCAAGCTTAATTGGCTAATAAGGAGTAATAGTC
TAAGCTAGGAATATGCTGAAAGAAAGCCCAAGTCATTAGCATTTATTCTCTAAAAATATA
CAAAACTAATTTCAAAACATGCTCAGCCTTGTAGAAAGCTATCAGCTTATCCTTCACGAT
ATTGAGTTTTCGTTGACAAACTCACCAACACTTACAGATAACACTACCGAAAAAAGCCCA
GAAAAGAACTAAGCTTTAAGACCAGTTGAGAGTACCAAACGCTTGAAGGCAATTTATCAA
CATCTCTATAAGGATTTCATGATACCTGATAAAACTCTCCCTTTTGCCTTGATCAATATA
GAGACAAGTATTTTGAACTATGACCTAAAACTCAAAGCAGATATGAGAAAATTCTTCTTC
AAACCAGAAACTGAAAAACAAATTTATGAATTATTGAGAGCAAGCACTCTTTAGAGGTTC
AATTGA


>Contig17564.0.g86(protein)
MIKLKTKVIFIMKAKINKDMGVLGFDVIDNGIGIQESEFDDNYLRCMPQRERNEIYKSRS
IGYKGEALDCLARLGKLTILSKFANKNLTQVVSFNKMRQVEQSSYINKCSSLIGQQGVIV
QARNMLKESPSHQHLFSKNIQNQFQNMLSLVESYQLILHDIEFSLTNSPTLTDNTTEKSP
EKNQALRPVESTKRLKAIYQHLYKDFMIPDKTLPFALINIETSILNYDLKLKADMRKFFF
KPETEKQIYELLRASTLQRFN