Identifiers and Description

Gene Model Identifier

Contig13066.0.g26

Standard Name

DGB1

Aliases

Contig13066_0_g26

Description

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam02518 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13066.0.g26(coding)
ATGGAAAGTAGTACTTCATCACAATAATCTGCTCACTTCTCTAAGCTCATAGAGGAAGAA
AAACAGCAAACAAGAAATCGAAAAATTGCAGCTTCTATCAATGATTCAATTGAGTAACTT
GAGAGTGAACCTCACGCTGTTGTTAGATGGGTTTGGGAGCTCGTCCAAAATGCTTAAGAT
GCTGCTAACCCTGGCCAGAAAGTCTAGATCAGGATCATTTTGGAACATGACAAACTGATT
TTCAGCCATACTGGAAAACCATTTAATCTAAATGACATCCTAAATCTAATAGAGCAAGGA
TCAAAGAAAGATAGGCCTAAGAGATAAAACTAAGACGATTTAACCTAGAAGGCTCCTCAA
GAAACTCCAACTCCTATTGACCCCTAAACTTCGATATTAGAGTATCTCACAATTCCTACG
ACAACAGGAAGATTCGGAACAGGATTTCTGACTACATATCTTTTGTCAAAGAATGTAGAA
GTTTAAGGAGTCTTTCACCATATCGATCAACAATCAAATGAATCAACCTTCAGAAAGTTT
AGCCTACTTCTCAATAGAGATGCTAAGGATTTGGATCACATGATTGAGCTCAATTAATAA
TCTGCGAAAATCTTCTAGGAATTAGATGATACTAACATTTGCCCCATTGTTCCTGACTAT
GAACCTGGCTTGGGATATGATACACAGTTCGTTTATCATATTGATGAGGAAGGATACAAG
AATGCATGCGAGGGCTTCTATAGTTTAAGCACGGCTTCTCCTTACGTACTAGCTTTCAAT
GAGAAAATTCAAACTTTTCATTTGGTTGATATTTAAGAGAGAGATTTGAATGGAAATGTA
ACTCAATAAGGCGAGGTTTTGCTAATGCTAAACAACATACCAAAGTTTAGTGTGACTGAC
ATCAAAATCTTGCACTACATCTATAGACAACTAGGTGAACCAGATATCGACAGATACTTC
ATTTAATCTCAGGGGAGGTATTCACAAATAGTCGCGGAAGTGAAAATTTTAGATGAAAAG
CTTGACAGATATGAGTTTTTAGCAAAAGATCCCTCAATCCCTAACTTTTTTGTGGATTAT
CCATTGATTGGTTCTGAGAGTTTAGGAACAGGAGTGGTCTTTAACTCTCATGCTTTTTAT
CCTAATGAAAAGAGATCGGGTATTTAACTGGTTAAAGGTAAAAAAGCTGCGGTGAACAGA
GAAATTATGACTGATTGCAAGGAGAACTTTGAGCAATTTCTTAACTTTGTGATTGAGCAA
AAATACTCAGGGCTCTAAAACCTCATAATGAAACTCAATCCTTAGTAGCAAGTCAATGAT
TACTTGAAAGAGATTCTACTGGACCAAGTCATTAAAATTTTCCTCAATAGAGAGGTTATT
GAGAGTGAGTTGGGTTTCATTATACTGGATGATGCTATATTCCCATGGATTGATGAAAAA
CAAAGAAGTTTAAACTTCAACTAACAACTGGAAGACTTGTGGGATTTAGCAAATTATTAA
TATGGTAAATCAGGATTATTGATTAAGAAGAATGTGAATTATATCATGGATTGGGCTTAA
GTTTATGATGACAAAGACTGGAAAAATCACTTGAAGCAAAAGAATCTTGTCAAGCTAGAT
GACATCTTGATCTACATTAGCAGCTTCAAAACTTTAAAAGAGTTAAAGTATGAGTTAGAA
TTGCCTAACATTCAAGGTACAATTGACTATCTCAACAAAGTTTACAAATACCTGAAAGTT
TATTGTTAAAACGAATAAGAACTTAAAACTATCCTTAAAACTTACAAAATATTCCCAAAT
TAAGAAGAAAACGGAGACTTATGCTATTTAATTGAACTTTATTAGGATATAAACATAGAT
GAGAAATATAAGAACATCTTTGAGGTAAACAACTGCAACTTAAGAAAACATTTATTGCAC
AAAGATATATAATTAGAGTTCGATAGAATGGTTGAGATATTCAGTTTCTAACTTCTAGAA
GAAATAGTTTGCAATTCTGTAAATAAGCACTATCAAAATATAAAAATTAATTTGAAGGGT
AGAGGAGGAGGACTTTATGGTGGAAGCGTTCATTAACAAAGATCCATTGGATTAAATGGA
ATGCCTCTTGCAGCATTTGGATAACCGCAAGGAATCTAATAAGTAGCAAACTCTCTTCTT
AATGATGAACCGAAGAAACCTGAACTTGAGCTATAATTTGCTAACTTTGACAGTCTCTTT
AACTTAGCTCTCCAACTTATTTGTTTCACACCAAAGAAAGTGATTCCTTTCAAAAACAAT
GCTAAAGACTAAAGAAAACCTTCACTTATAGATTACCCTGAGTCAAATCCGTTTGTTTAG
TAACATCTTTAAAATAAGCAGTAAGTCCAGGAAGAAGAGAAAAAATCATCTATAAGTGCC
TTTGGATAGCTTGGCTAAGCACCTAAGTCAGTGATAATACCTTAAGTACAAAATAGGTTG
AGTTTGGATTAGTAGAGAAATTCCTTACTTGAATTGATTGACAAAACCATATACAGTGCT
TAGGTGAAGCCAATTTATTCGGACAACATTCCTTCTAAAACTTTTGAGTTAGGTCAATAA
ATTATTCTTTTGAAGTTCAGAAAGCAAATTAGGTCTTTTACCTAAATGAGTCAGCTTTCG
TAGAGTTTGGTCAAGTAGATATAGCCTTTAGAGTTTCTCAAATTATTTTATGGATAATGC
AAGGATATTTTGAGACTTCAAAGCTAAAAAAGTATAATTTCCAAGAAAATAGTACCTAAT
CAAAATGGATATTTCTCATTTACCAACAATCTTGGTATTCAGTATAAAGTCAAGTTCAAC
CAAATTTATGAATGCAAATAAGCTCAGTAATAAGTTAACGAACTTATCAAGGCGTTATTT
GAGAAATATCTCACATTGAGCAACTAATAAGCATAAGTATTTAATTAGGATATTGTGCAC
TCAGATCTCAACACTTTGCTCTTTTAACATGCAGGTATTACCTTTTATGATGTTTTCACG
CTCAAGGATCTGACCACCTATGTTGATGACAAAATAGTGACAATTGAGAATAGCAGGGAC
AGACATGAAAACTCAAAGTAATCTATTGATTTGCTTGAAAAATGCTACAATAAGCTTGTC
ACACACCCTTGCAAGCCAGAGTATTTTCCAAAGTATCACCTTCAAAGAAAGAATATCCAA
GTGAACCTAAGAATGACAGATCCTCTCACAAATGATATATTTGAAATTATGGAAAATTAG
CAACAAGATTAGCTACATCAATTGTGCAAAATATGCCCAGATTCTTATGATTTTATCAGC
AAATTACTAGTTCTAATGTATGATAACAAGCCATAAAATGAGTTAATTCAGCTTTTGAAG
ATATGCATGGATTGCAACTTGTAAGATGATGAAATCAAACATCTAGGCAGTCTTATTAAG
CAAGAGAAAGATAGCAAAAAACAGGAAGAAGAAAAGGAAAACTCAAACTATTAACAATCT
CAGGATAAACCCAGCAACCAGAATTAATTGTAACAAACTTTGAAATGA


>Contig13066.0.g26(protein)
MESSTSSQQSAHFSKLIEEEKQQTRNRKIAASINDSIEQLESEPHAVVRWVWELVQNAQD
AANPGQKVQIRIILEHDKLIFSHTGKPFNLNDILNLIEQGSKKDRPKRQNQDDLTQKAPQ
ETPTPIDPQTSILEYLTIPTTTGRFGTGFLTTYLLSKNVEVQGVFHHIDQQSNESTFRKF
SLLLNRDAKDLDHMIELNQQSAKIFQELDDTNICPIVPDYEPGLGYDTQFVYHIDEEGYK
NACEGFYSLSTASPYVLAFNEKIQTFHLVDIQERDLNGNVTQQGEVLLMLNNIPKFSVTD
IKILHYIYRQLGEPDIDRYFIQSQGRYSQIVAEVKILDEKLDRYEFLAKDPSIPNFFVDY
PLIGSESLGTGVVFNSHAFYPNEKRSGIQLVKGKKAAVNREIMTDCKENFEQFLNFVIEQ
KYSGLQNLIMKLNPQQQVNDYLKEILLDQVIKIFLNREVIESELGFIILDDAIFPWIDEK
QRSLNFNQQLEDLWDLANYQYGKSGLLIKKNVNYIMDWAQVYDDKDWKNHLKQKNLVKLD
DILIYISSFKTLKELKYELELPNIQGTIDYLNKVYKYLKVYCQNEQELKTILKTYKIFPN
QEENGDLCYLIELYQDINIDEKYKNIFEVNNCNLRKHLLHKDIQLEFDRMVEIFSFQLLE
EIVCNSVNKHYQNIKINLKGRGGGLYGGSVHQQRSIGLNGMPLAAFGQPQGIQQVANSLL
NDEPKKPELELQFANFDSLFNLALQLICFTPKKVIPFKNNAKDQRKPSLIDYPESNPFVQ
QHLQNKQQVQEEEKKSSISAFGQLGQAPKSVIIPQVQNRLSLDQQRNSLLELIDKTIYSA
QVKPIYSDNIPSKTFELGQQIILLKFRKQIRSFTQMSQLSQSLVKQIQPLEFLKLFYGQC
KDILRLQSQKSIISKKIVPNQNGYFSFTNNLGIQYKVKFNQIYECKQAQQQVNELIKALF
EKYLTLSNQQAQVFNQDIVHSDLNTLLFQHAGITFYDVFTLKDLTTYVDDKIVTIENSRD
RHENSKQSIDLLEKCYNKLVTHPCKPEYFPKYHLQRKNIQVNLRMTDPLTNDIFEIMENQ
QQDQLHQLCKICPDSYDFISKLLVLMYDNKPQNELIQLLKICMDCNLQDDEIKHLGSLIK
QEKDSKKQEEEKENSNYQQSQDKPSNQNQLQQTLK