Identifiers and Description

Gene Model Identifier

Contig10553.0.g32

Standard Name

DFF1

Aliases

Contig10553_0_g32

Description

DNA fragmentation factor 40 kDa

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam09230 ) DNA fragmentation factor 40 kDa
  • ( pfam11068 ) Protein of unknown function (DUF2869)
  • ( pfam04977 ) Septum formation initiator

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10553.0.g32(coding)
ATGGAAAGGAAAAAGGAAGAGCCGAAGTAGCTGTTTGCTAACAATTAGGGTGATTTCGGA
AACCATCTTTCAAATTAATTTAATAGGGAAGTATTGGAAAGAAATTAAATATTGTAAAAT
GGGGAATAAAGGGCTTTTGAGAGATTAGGAGTTCATCCTAATGCGAATATGGCTGTTTAG
AGGGGCTAAGTATTTGAAGAGATTACATTTGCCCTAATTGAAGCTCAGATTCATGATCAT
TAGCTACCAATCCGTGTTTACCAAGGCGATGGCCAAGGCATGATAGAATTTAATGGCTAA
TTAATTAGGACTCCTGATGGCACAGATATGATTATAGAAAATTAGTTATTTAGAGACCTA
ATTGAGATTTTACAACTAAAAGTGAGCAATACTCCTGAGGGATTAAGACATCTTGTCCGA
GAAAGTTTTGATATTCATCCAGATGGAACAGCAAGGCCAAATACTGCAAATGCAAAGCTT
GACCCAGACTTCTATGAAAAGTTTCATCCAAGAAAAGCTAAATTTGTAACTACTAGAGGA
AATGGATAGACTATTGAAGTCACCAATGGGGATAGAATTGAATAAGTTGAGGTGTCTGAC
AAAGTAATTGTTGGAGACAAAGAAATCTAAGTGCCTAGTAGTCAAGAATGTGAAGATTGG
ATTTCAAAGCTTCAAGCTCTAATACCAAAGTAAGCTTAAATTCATGCAAATAAGCAAAAG
ATTTAATGGTTAAAAGGTGTTGTTAAGAGACTTTAAAGTTAACATGATAAAATACCAGAT
TCCAAAATTGAATCTAGAAATAGGTTTCAAGAATAAATTAGCAAAGCATATTAAGAACTT
GAGAAATTGGCAAATGATACTAAATAGTTAGAAGTAGAGATTGAATAGGACTTTGTCGAA
TTTTTCCCCAAAATTAAATCCAGGGATTTTATCTTTTCTAGAATGAAAGAAGCAGCCATT
ATTGGAGGATTAGTTTCTGGAGTCTAAGCTTTGATTATTTCATTTATAGATAATCTTTAA
AAATACCAGAAAGGGGAGATTGGTATACTTTAACTTTTTGAGTCTGTAAGTTATGAAACT
ACAAAAGGAGCAGTCAAAGGAGGAGTTTTGTCTGCACTTATTGTAGGTTTTGAAGCTTAT
GGAATCAGCTTACTTGCTGAAAATTCAGCAGATTTATTAGGCCATGTCTTTAAGAAGGCT
GGTGTATTATGCTTGAATGGATAACTTTCAAAAGAGGAAAGTCAGATTAAAATCGCAAGA
ATTTCAGTAGTAGGGATCCTTAATACTTCAATTTCAGTTATTGCAGCTTCATGTTGGGGT
GGGCCTGTTGGAATGCTTATTGGAATATCAGGTAGTCTTATTGTCGGTACAATAGATTAT
TTCTTTGGGTAAAGCATTTGTGATAAAATCTTTCCACAAATTTAAAGAATAGAAGGGATA
CCTCCTCTTGGCTGTGAACCGATGCAAAAGCCATAATTTGGACTTTAATTTTAGAAAAAG
CCAGATTTTCACCTTGAGCTTCAATAAAAACCTCAATTTGGATTGAATAGGCAATAAGCG
CCGAGATTTTTTTGA


>Contig10553.0.g32(protein)
MERKKEEPKQLFANNQGDFGNHLSNQFNREVLERNQILQNGEQRAFERLGVHPNANMAVQ
RGQVFEEITFALIEAQIHDHQLPIRVYQGDGQGMIEFNGQLIRTPDGTDMIIENQLFRDL
IEILQLKVSNTPEGLRHLVRESFDIHPDGTARPNTANAKLDPDFYEKFHPRKAKFVTTRG
NGQTIEVTNGDRIEQVEVSDKVIVGDKEIQVPSSQECEDWISKLQALIPKQAQIHANKQK
IQWLKGVVKRLQSQHDKIPDSKIESRNRFQEQISKAYQELEKLANDTKQLEVEIEQDFVE
FFPKIKSRDFIFSRMKEAAIIGGLVSGVQALIISFIDNLQKYQKGEIGILQLFESVSYET
TKGAVKGGVLSALIVGFEAYGISLLAENSADLLGHVFKKAGVLCLNGQLSKEESQIKIAR
ISVVGILNTSISVIAASCWGGPVGMLIGISGSLIVGTIDYFFGQSICDKIFPQIQRIEGI
PPLGCEPMQKPQFGLQFQKKPDFHLELQQKPQFGLNRQQAPRFF