Identifiers and Description

Gene Model Identifier

Contig21964.0.g20

Standard Name

DENR

Aliases

Contig21964_0_g20

Description

Translation initiation factor SUI1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004422401.999598840915195e-17Translation initiation factor
SUI1 family pro...
SGDYJR014W2.0004286606204839e-16TMA22 SGDID:S000003775, Chr X
from 461829-462425, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21964.0.g20(coding)
ATGAAGCAACACAAGGAGACTATTTTGGTGACTGCTGTTCAAGCAGCCGAGAACAAAAAG
AAAAAGAAGCAACAAAATGCTGGTTTTATGTATGGCAATGTGGCTGATGAAGAGGAGAAA
ACCGCATAAACAGATGCCTAATAAACTCAAGAAGAATAGCAGGAAGAACCCAGAGAAACT
AAGGTAAAATTTGAAGAACCAGATAGAGAAGAAAAAGGAGGCAAGGGTAAGAAGCATCAA
GGGAAAAAGGGCCAGAAGAAGGGCGGCAAAGGCAAAAATGCTCAAGATTCTGAGGAAGAG
GAAGTGAAAGAGTCACAATCAGATAACAAGGCATAAGAAGAGACCAAGCAAGTGGAGTAG
GAAGAGGAGAAGAAAGAGAGTGAGAGTGAATTCCCACTTAAAGTAGTATACTGCAAAATT
TGCGACGTACCTCCTGAATATTGCATGGTGGACAAGAAAGATTTCACAGATTGCATAAAT
TGGTTGAAAGCAGAGCACCCAGACCTCTTCGAAGAGCTCTATGACAAAGAGACTTGCAAA
GAATCTCTTTTAAAAACCCACCCCCTTATGTACGCTAAGATCTTCCCAGAGGAGGAAGGA
AAGACTGAAGAAACAAAAGATCAGCCACCTCAGAAGCAATAAAAGCAGAAGAAGAAAGTT
GGTTTTGGTACTGCCAATTAGGAAGTCAAAATCTATAAGACTCGTCGTGGAGGAAAGAAA
GTCATTTGCTCAGTTACTGGATTGCAGGGATATGGCGTGAACTTGAAAGATACTGCTAAA
TCTATGAGTAAGAAGTTTGCTTGTAGTGCTGCTGTTACTACAGACGATAAATACGGAGAG
TGCATTCAAGTTCAAGGGGATATTCAAGAAAGATTCTTCGATTTCTTGGAGAGTGATCTT
TCTAAGTACAAAATTCCAGCTAATAAAGTTGTCTTTGAAGAGATAAAGAAAAAGAAGGCT
GGTGCAACTACTGGGCCAGGAGGAGCTGGACAAGAAGGTGGTGATGATTAAGAATGA


>Contig21964.0.g20(protein)
MKQHKETILVTAVQAAENKKKKKQQNAGFMYGNVADEEEKTAQTDAQQTQEEQQEEPRET
KVKFEEPDREEKGGKGKKHQGKKGQKKGGKGKNAQDSEEEEVKESQSDNKAQEETKQVEQ
EEEKKESESEFPLKVVYCKICDVPPEYCMVDKKDFTDCINWLKAEHPDLFEELYDKETCK
ESLLKTHPLMYAKIFPEEEGKTEETKDQPPQKQQKQKKKVGFGTANQEVKIYKTRRGGKK
VICSVTGLQGYGVNLKDTAKSMSKKFACSAAVTTDDKYGECIQVQGDIQERFFDFLESDL
SKYKIPANKVVFEEIKKKKAGATTGPGGAGQEGGDDQE