Identifiers and Description

Gene Model Identifier

Contig10427.0.g78

Standard Name

DDXH9

Aliases

Contig10427_0_g78

Description

tRNA ligase kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005718000.00020003864201578029hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10427.0.g78(coding)
ATGAACACAGTATTGTCGTCATAGAATCACTTGAAGCGCATATTCTTGATTCCAATAGGT
CTCCCCGGATTGGGAAAGACCACACTTGCAAAATGCTTAGAATCTACTTTCTCAAACCAA
TTTATTAGTTCATAGGCAAATGTCAATAAAAACTCTTCGGAGAACATTTCAACATTAAAT
AGCAGAGTACATTATACAAGAGTAGACTATGATAAAATGCTTCAAGATTACTAGCAAAGC
TATTAATTAAAACACCCCGAAACCCCCTTTCATTAAATTATAGATATTGTCAGAGGGCAA
GCAGACAAGAAATATCTTCAAACTATATAAGGGATTAGCAATCAATAAACTAATAAGCAT
GGGTAGTAATTGATATACTTAGATAGAAATAATACTCCAGATATATGGAGAGATATTACG
TCAAGTATTAAACATGAAAAAGGTGATGAGGTCAGCAATAATTCGTAAGATTTGAAATTA
AATTCCAAAGATTAAACTGTTTTGCTTATGCCTAATCAACCAGATATGTCAAATTTCACT
AAGTAGTATAACAATCCCAATCCTATAACCCCTCTTTTGCTTTATCAATGCATAAAAAGG
ATATTCTCTCGCGCTAATCACAGCTGTCTTTCAAGTTAAGACAAGCCAAAAGTCATTGAA
GTTTTATTAAAATTTATGAAACTTTATGACAACGTATGCTTTGACAAATCTATGATCAAT
AATCAATAACTTGAATAAAAACATGAAGCTACAAAGACATCTAAATACAATTTAGACTAA
TTTGATAGTACTTTTAACTTAGACTTCCTTGATTATAGCTTATGTGATAATAATGCTATT
AATGTTGAATAAAATTAATTTGGACTGGAATTAGATACGATAAAAGTACTAATCGATGGG
TATAATCAAACCCCAGAAGACTTTAAGCCACCGAGTGATGAAACAATTGCTTTTGTCCTC
AAATATGTCGAGAAACAAATACACATTGATAATGTGAAGTAATAAGCTAAAAATAAATAA
GGAGAAGCTGCTGCTCCATTAGGATATTTCAGTGATGTATAATCAATGCTTGATAAAATT
TATAGATAAATCAGTGAACAGGCTCAAGATAAAGATTAATCAATAGTCAACGTGTAACAA
AGTTGTGATATTGGAAGCCAAATCAAAACTGATGGAAAATTATGA


>Contig10427.0.g78(protein)
MNTVLSSQNHLKRIFLIPIGLPGLGKTTLAKCLESTFSNQFISSQANVNKNSSENISTLN
SRVHYTRVDYDKMLQDYQQSYQLKHPETPFHQIIDIVRGQADKKYLQTIQGISNQQTNKH
GQQLIYLDRNNTPDIWRDITSSIKHEKGDEVSNNSQDLKLNSKDQTVLLMPNQPDMSNFT
KQYNNPNPITPLLLYQCIKRIFSRANHSCLSSQDKPKVIEVLLKFMKLYDNVCFDKSMIN
NQQLEQKHEATKTSKYNLDQFDSTFNLDFLDYSLCDNNAINVEQNQFGLELDTIKVLIDG
YNQTPEDFKPPSDETIAFVLKYVEKQIHIDNVKQQAKNKQGEAAAPLGYFSDVQSMLDKI
YRQISEQAQDKDQSIVNVQQSCDIGSQIKTDGKL