Identifiers and Description

Gene Model Identifier

Contig1010.1.g86

Standard Name

DDXH8

Aliases

Contig1010_1_g86

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011285703.999751664085691e-132ATPase, AAA family protein
SGDYPR173C1.0004671766404936e-76VPS4 SGDID:S000006377, Chr XVI
from 887837-886524, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1010.1.g86(coding)
ATGGGTTAGAAAAGAGCGTAATGGCAAAAAAATAATGATGCAAACTATTGCGGAGGAGAG
TGTCAGGAAAAGCAGTGGGTTGGCAGCTTAAAGCTTGCAGAATTCATCACCTGGAAGATA
AATGTGAAATACTCAGAACATTAATAATTAATAAAGCAACAATATAAATCAGTCTTTTGG
ACCATCGTCGTAATAGGTTCATAATTCAACCTAATTCAGTTAATCCTCGATACCCCCATT
AACCTAAAACAGCTAAATCTAACTGGGTATTGCTACGACTTTATTTAATCCACTAGCTAC
AAATTAATTGTTCAGAGAGGCCTTGCAATAAAATTGGGTACCAATCAAAGAAAGTCTACT
GAAATATATGTTAGAACTCTATTAGAAGAAAATTAAAGCACTAACAGTACCATTAACAGC
ACAAGCTAGTTGGCATCAAGGAGCACGGTCAGCAAATAGGGGTCAAGTATCTAGGCACTA
TCAGCTCAGGGGTTCAACCATAGTTCTAGTTCTGTATCAGGCTTCCCTATTACAAATTCG
AGGAGGAAGAGGACTCATAATAATGAGACCAATAACGATGAGGAGTTGAAATAAAATTCT
TTCTAAAGACAGAGTTCACATCAGGCAGTATCATCTGTGGCTAATTCAATAAAAACTAAT
ACGACGAATAATGACGGAGATTAAGCTGATATGTTCTCAAATGACGATCCTTAAATGTAA
ACCTAGTTCAGAAGAAATTAAAGCTCAAATCAGTTAGTATCTTCTAGTATCGGATAGAGC
AAATAAAGATTAAGTAAAGAAAATGTTAAGAAAGTGGCTGGAGGAAGTGGAGATCGCACA
AATGAAGACTAAAAGGAGAATCTCGGTAGTAACGAGCAATCTGTTATAAAATCAGCTTAG
CTATAGAATGACTCAAGTACTTCTTATTAAGTTGGACTAAACATATTTGAGGAGTTATCA
AATAAATACAACAAAGAACTTAAGCAACAGCTGAAAAGATGTATTATGACGAAGTAGCAC
AACATGTGTTTTGATGATATTGCTGGAAACGAATATGCCAAAGAAATAATTTACGAGACT
TTCATTTTACCAGATGTAGCACCACAAGTATTCAAGGGCAAAGCAAGGCCTTGGTAATCG
ATATTACTATATGGTCCACCAGGGGTTGGAAAAACTATGCTTACTCAGGCAGTGTGCCAT
AAATCAAAAGCAACTTGTTTCTGGGTTTCCCTCGCAGATATAACGTCTAAATTTATTGGG
GAGAGCGAGAAACTGCTTCAAATGCTGTTTGAACTTGCAAGAGAGCATAGTCCGTCAATT
ATTTTGATTGATGAAATGGATTCATTAGGTAGAAAACGCACGGGCAATGAAAGTGAAACT
GAAAGACGTATTAAAACTGAGTTTCTGAAACAGATGGATTAAATAAAGAATATACCAGAG
AGGGTTTCAGTTTTTGCAACTACAAATATGCCTTGGGAACTTGACATTGCTGCTCTTAGA
AGATTTGAAAGGAAAATCTTAGTACCTATGCCCGATAAGGAAACACGCAAAAAGGTCATA
AAACTTCATAGTGGTACTCATCACACTTTAAGTGAAGAAGATATGGAGTTCTTAGCAGAG
CATACAGAAGGTTACTCAGGGAGTGACATGTCAACTTTGGTTAATGATGCTTTAATGAGG
CCGATAAAGCAACTTTAACAAGCTACCCATTTTAAACGAGTAATGAAAAAGGATTTGCTT
GACTTACTTAAGAACGAGCATTTAGAACAATCTTAATTAGTAGATGAAGACGAGGAAGAG
GACTTAACTGGAAGTGTTTGGATGCCAATAATTTATGATTAAAAATCTGAAAAGGCCAGC
TAAATATAAAACGATCCTGACGTCAAAGAAATGGATTTAGCTGCAATATCTGAAAAGGAA
GTCTTCGTTAGAAAAGCGGATCTTTCTGACTTCAAACAGAGCATAGATAATTGCAAACCG
ACAATACATATCAGCTTTTTAGAGTTGTATGCCAAATTCTTGGAAAAATATGGTCACTCT
GATTAAAAAAACTACATAGAATAGATTCGAAAATTATAATAACCACAGTATTTATCCTAC
TATGCATGA


>Contig1010.1.g86(protein)
MGQKRAQWQKNNDANYCGGECQEKQWVGSLKLAEFITWKINVKYSEHQQLIKQQYKSVFW
TIVVIGSQFNLIQLILDTPINLKQLNLTGYCYDFIQSTSYKLIVQRGLAIKLGTNQRKST
EIYVRTLLEENQSTNSTINSTSQLASRSTVSKQGSSIQALSAQGFNHSSSSVSGFPITNS
RRKRTHNNETNNDEELKQNSFQRQSSHQAVSSVANSIKTNTTNNDGDQADMFSNDDPQMQ
TQFRRNQSSNQLVSSSIGQSKQRLSKENVKKVAGGSGDRTNEDQKENLGSNEQSVIKSAQ
LQNDSSTSYQVGLNIFEELSNKYNKELKQQLKRCIMTKQHNMCFDDIAGNEYAKEIIYET
FILPDVAPQVFKGKARPWQSILLYGPPGVGKTMLTQAVCHKSKATCFWVSLADITSKFIG
ESEKLLQMLFELAREHSPSIILIDEMDSLGRKRTGNESETERRIKTEFLKQMDQIKNIPE
RVSVFATTNMPWELDIAALRRFERKILVPMPDKETRKKVIKLHSGTHHTLSEEDMEFLAE
HTEGYSGSDMSTLVNDALMRPIKQLQQATHFKRVMKKDLLDLLKNEHLEQSQLVDEDEEE
DLTGSVWMPIIYDQKSEKASQIQNDPDVKEMDLAAISEKEVFVRKADLSDFKQSIDNCKP
TIHISFLELYAKFLEKYGHSDQKNYIEQIRKLQQPQYLSYYA