Identifiers and Description

Gene Model Identifier

Contig609.1.g98

Standard Name

DDXH7

Aliases

Contig609_1_g98

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008650500.0000000039998859049333245hypothetical protein
SGDYJL194W0.00000019998969434520019CDC6 SGDID:S000003730, Chr X f
rom 69338-70879, Genome R...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig609.1.g98(coding)
ATGAAGTCCAATTTACATAGAAAAAGAGTTTTCTCATCAAAACCCACAAAAGCTACAGAT
GATAAACTTAGTGAGAAATCTCGTAAATCTAGTAAAAGCAGAGGCAGAACTTCTGCCCCT
AAGAATTCTCCAACAAGAGTAAAATCTCAACCTAAATAAGTAAAGCAGGTTAAGAAAGAA
ACAAAGAGATCAGAGAGTTATGAAAGCGACAAGGAGAATATGATCAAGCAGACTTAGGAA
TAAATCAACAAGAGAAGAATACTTACCCATAACAAAACTACAGCTAAAGCTGCCAAGAAG
TAAGATCAATAGGCAATTTAGGAGTAAGTCAAGCTAACTGTGAAAGATGTTGTTGAATTC
TATCAGAAAGCTTTGAGTGTTTTCTAGTGCAAGGAGAATGAGATTGTTGGTAGACACTAG
GAGGAGAAAGAAATCAAAGATTTTCTGACTTAAAACTCTTAAAAAGATTTGTCAGGTCTG
TTGTATATCTGTGGACATCCTGGTACTGGAAAGACTTCATTAGTGACTTAAATCTTGAAT
TAAGAGTTTGAAGATTCCAGCAAATACTGTTTGATAATGGTAAATGGCAATAGCTATCCA
AAAATTGAAAATTTATTTTCTGATTTGAGATCTAAGATGTCTACTTGCTTGCAACAGTCA
AAGTACTACAACAAGAAATCGATGAGTTACATAAATCTTAAAACTCCAAAGAATTTGGAT
ACAGAAGATCAGTATAAGGAGCTTGTTGATTTTATCAATGTTTGCTACAAATTGTGCAGG
TTAAAGCACATTATTCTTATGATTGATGAAATTGATGCATTTTCTTTTCATAGTTAAGCC
TCAAGCTACTTCAACATCTTTCTTAAAATCTTGCTGAAGTTTAACACTTTGTCTGTTTCA
GTGATTGGTATTGCAAACTCAGTTGAATTGTTCAAAGGAGAGTTAACTTCAAGCAACAAC
AAACTCAATTCTGCTTTCTTATGTTAAAATGAAATGAAAATCATTTTTACCCCATATGAC
AAATCTAAAGTCACACTAATTCTCAAGACCCTTGTTGACAGGTTTATACATAAAAACTAT
TCAACAGTAAAGTCTCAAAATAGCATGAGAAATTTGATTGATTAAAGATCTTACGACATG
GTTGCCTTGAAAGTGGAGAAAGTGAGTGGTGATTTGAGAACCTCTTTTAATATTATGCAA
TGTGCTATTACAGAAAAAGTTAAGTTCATAAAAAGCTTGTCTGATAAGGAGGCTATCTCA
AACCCAAAGACTTTACTGCTCACTTATGAAGATGTAAACAAGGCAATTATTGAAATCTAT
CAATCTAAAACAGCCAATATAATTAAGCAAGTCCCAAGATCACACTTGATTTTCTTGTAA
GTATTGTATGAGACCTTTGAAAATGAGAATGTGTGCGTGATTGGAGAAGATAGGCTTTTG
GATCTCTTTAATAGAAGATATAGTGGACACTCTGGCTAACTTTAGCATTCTGAGTACCAA
GGATATTAAATTTAACCCTGGTGA


>Contig609.1.g98(protein)
MKSNLHRKRVFSSKPTKATDDKLSEKSRKSSKSRGRTSAPKNSPTRVKSQPKQVKQVKKE
TKRSESYESDKENMIKQTQEQINKRRILTHNKTTAKAAKKQDQQAIQEQVKLTVKDVVEF
YQKALSVFQCKENEIVGRHQEEKEIKDFLTQNSQKDLSGLLYICGHPGTGKTSLVTQILN
QEFEDSSKYCLIMVNGNSYPKIENLFSDLRSKMSTCLQQSKYYNKKSMSYINLKTPKNLD
TEDQYKELVDFINVCYKLCRLKHIILMIDEIDAFSFHSQASSYFNIFLKILLKFNTLSVS
VIGIANSVELFKGELTSSNNKLNSAFLCQNEMKIIFTPYDKSKVTLILKTLVDRFIHKNY
STVKSQNSMRNLIDQRSYDMVALKVEKVSGDLRTSFNIMQCAITEKVKFIKSLSDKEAIS
NPKTLLLTYEDVNKAIIEIYQSKTANIIKQVPRSHLIFLQVLYETFENENVCVIGEDRLL
DLFNRRYSGHSGQLQHSEYQGYQIQPW