Identifiers and Description

Gene Model Identifier

Contig526.1.g121

Standard Name

DDXH6

Aliases

Contig526_1_g121

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR046C2.9997246065828143e-59DBP5 SGDID:S000005572, Chr XV
from 415907-414459, Genom...
T. thermophilaTTHERM_002207503.9998411574835458e-50DEAD/DEAH box helicase family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig526.1.g121(coding)
ATGGTATCAAAGTAAACTGAATCAGCATCCAATCTCACTTCCTAAAATGAGGAAGAGAAG
AAAGAAGACCAACAGAAGTAGTTGATCAAGGGTATGAGGTCACTGGAGTTTAAGAACATC
ATTACTGATTTGCAATCGAAGAAAGTGATGTGGAAAGACATTGAAGTCCCTGACATTATG
GTTCAAAATGGACTCAGTGAAATGGATTACTCCAAGCCATCTCAAATCTAAGCTCATGCT
ATCCCCAAGATCATGCAAAACTCTAGCGAGAGCTACTTGTTTCAAGCTGGAAACGGCAGT
GGCAAGACTGGTGCATTTGGAATCCCAGCCATTTTGAGAGTGAACCCTAACATTCAGGAA
ACTTAAGTCATTATCTTTGCTAATACAAGGGAACTTATTAGACAGATCAAGGGTGTGCTA
GACAGACTTGCAACAAAGATGAACATCTCTATTGAGATCGGCGAAGGTTCAATTATCAAG
AAGGCTCAGATCCTGATCACAAGTCCAAACTATTTCACCAACAAGTTAGCAGGAAGAGGC
TCTAATTTGGACTTCAGACATGTGACCATGGTGGTTTTCGATGAGGCTGATGAAATCTTT
AAGCAAGAGAACAACCGTGAAGTGATCCAATCTCTTATTGATAAGGAGCTAAAGAAACGT
GGAGTGAGTCCTCAGTACCTCATCTTTTCAGCTACCTTTGAACAGGACATCATTGATCAG
TTCTCTAAGATTGTGGGAGAATTCACTTCATTTAGAGTGAAAAAGGAGTCACTTAATCTT
AAGGGAGTCAAGCAGTACTACATCATTCTTGATAACAATAGCAAGTGCTAATTTGTGGAA
GAGTTCTATAAAAAGAACTCCAGAGTCCAAGCTATGCTGTTCACAAATACCAAAGCAACT
GCTAATTACTTGAAGGAGAGATTGATTAAAGAGAACCACAAGCCTGAGATCATTATCGGT
GGATTGCCTTTCAATGAAAGAGATAGAATCATCGATATGTTCAGAGAGACATCTTGCAAT
GCATTGATCTGCACAAATGTACTTGCAAGAGGAATTGATGTCCCAGAAGTAGATATTGTG
ATTAACTTTGACGTGCCTATAACCCAAGATGAAGGTTGGAAGGAGCCAGACTACGCCAAC
TACCTGCACAGAGTAGGCAGAACCGGTAGATTCGGTACAGACGGTCTTGCTTTAACCCTG
ATCGAAGATGACATTGATGGCTTCAACATCTCAATGATCAAGAAGATTGAACAGCACTAT
GGTAGTGAAATCAAGGAGGTCAAGTCATTTGAGGAATTTGCTGAGATCTACAAAACTATG
AGAGGAGGAGCTGAGATGAGCATTTGA


>Contig526.1.g121(protein)
MVSKQTESASNLTSQNEEEKKEDQQKQLIKGMRSLEFKNIITDLQSKKVMWKDIEVPDIM
VQNGLSEMDYSKPSQIQAHAIPKIMQNSSESYLFQAGNGSGKTGAFGIPAILRVNPNIQE
TQVIIFANTRELIRQIKGVLDRLATKMNISIEIGEGSIIKKAQILITSPNYFTNKLAGRG
SNLDFRHVTMVVFDEADEIFKQENNREVIQSLIDKELKKRGVSPQYLIFSATFEQDIIDQ
FSKIVGEFTSFRVKKESLNLKGVKQYYIILDNNSKCQFVEEFYKKNSRVQAMLFTNTKAT
ANYLKERLIKENHKPEIIIGGLPFNERDRIIDMFRETSCNALICTNVLARGIDVPEVDIV
INFDVPITQDEGWKEPDYANYLHRVGRTGRFGTDGLALTLIEDDIDGFNISMIKKIEQHY
GSEIKEVKSFEEFAEIYKTMRGGAEMSI