Identifiers and Description

Gene Model Identifier

Contig14886.0.g53

Standard Name

DDXH4

Aliases

Contig14886_0_g53

Description

Ras family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003397108.996537154595168e-51hypothetical protein
SGDYER031C5.999907735769095e-44YPT31 SGDID:S000000833, Chr V
from 214747-214076, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14886.0.g53(coding)
ATGGTGTCGAGAAAATCTTAAGTTGCATCTTAGGCTCAATTGGATTCTCTAAAAGCTGAA
ATATATCAAGTAGACCCTAATTATGACTTTAATTACGATGCTCAGTTCAAAGTTATAGTC
ATTGGGGACTCTGGTGTTGGAAAATCGTGCATTGTGCAGAGATTAACTTAAGATGTCTTC
AAGACTGATCATTAAATCACAATTGGAGTGGAGTTTGGCGCATTTGTCATGAAAATCGAT
GGAAAGATTATCAAGTTAATGATATGGGATACTGCTGGGCAGGAGTAATTCAGAAGCATT
ACAAAACTATTTTACAAAAATAGTGATGCGGCAGTAATTGTCTATGATGTAACAAAGAGA
GTAAGCTTTGAAGATGTGGAAGAGTGGCAAGAAGAAATAATAAATAATACCGATGAGGAT
GTTCTCCAATATTTAGTGGGTAATCGGGTTGATTTATAAGAAGAGAGGGAAGTCCCCACT
AATGAGGGTATCTAAGCTTCTAAAGACAAGAATTTCGCTTAATTTTTTGAGACATCAGCC
CGCACTGGTCAAAATATCAGTGTTTTATTCTAAACTCTCTCCAAACAATTGTATCTAAAA
AATAAAGACAGACTGGATAAATTTAGAGAAAAAGACGATACAGATCAAAGCATGAATTAC
AGATCGCAAAGTATAGCACTATCTCAAATTAATAAACAGCATACAATTAGTGGTAAAAAG
AAAAAGAAGTTTCTTTACGATTATTAAAAAGATGGAAATACTGAGCTTTCTAGCTATAGA
ATAGGATTTGGAAGTTGTTTCGATAAGAAACAAAAGCGAACAGATATCTTCAAGGACATT
AATTAAGAAAACTTGGATTTATGGATTTGGCTTGGAGATTTCGCATATGTTGATAAACAC
GTTGGAGTGATTATGCAGTATGTATATGGTCAGAATTACTTGATTGAAGATGAAGAGACT
AGGAGAAAGAAATTTGCAACTACTTATGAAGATGAGTACTACTCATTGTTGAAAAAATAA
ACGCCAGTAATTGGAATATGGGACGACCATGATTACGGGAAAAACGATGGTGATGCCACA
AATCCAATTAAATTAAACAATAAACAAGTTTACCTTGACTTTTTGGATGAGCCTCAAGAC
TCCCCTCGAAGGCATAGAGGTGATAATACTGGTATTTATGAAGATTATCAAATTAAACTT
AGAAAAGATTTCTCAGTTAGAATTATCCTACTGGATGTTAGATTTAGTAAGACAAAGGAA
ACTTTACTAGGCGATGATTAATGGAAATGGTTTGAAAATGTACTTAAAAACTCAAATGAC
TAAGTTTATCTCTTGGGCTCAGGTGTATAATTTATGATGAGAGATCGATTGATTGGTGCC
GAAAGATGGCCTGATAAAGAGTACTAAAGATTACTAGATTTAATCAAGCAATACAAGAAA
TCTGGAGTTTTTCTTCTAAGTGGAGATGTGCATCACAGCTAGCTTTTGTCACCAAAGTGT
AAACTAAACGGTTTGGGATATGAACTTACAGAAATCACTTCAAGTGGGCTGACTCATACT
TGTGATAGAAATTTGGCTGGACTTTGTAGTTACGCCTTGAAAGGGAACACACCAGGTACT
TACCCTATTTCACAGGTAGTTAAGCATTAAAGGCAGAGATAATTAAACATTCTTGTAGAG
AAGTTTTAACCTGATAAATTTTTAGTATTAAGAGAATTTTACTTCAAGATTCTGTGA


>Contig14886.0.g53(protein)
MVSRKSQVASQAQLDSLKAEIYQVDPNYDFNYDAQFKVIVIGDSGVGKSCIVQRLTQDVF
KTDHQITIGVEFGAFVMKIDGKIIKLMIWDTAGQEQFRSITKLFYKNSDAAVIVYDVTKR
VSFEDVEEWQEEIINNTDEDVLQYLVGNRVDLQEEREVPTNEGIQASKDKNFAQFFETSA
RTGQNISVLFQTLSKQLYLKNKDRLDKFREKDDTDQSMNYRSQSIALSQINKQHTISGKK
KKKFLYDYQKDGNTELSSYRIGFGSCFDKKQKRTDIFKDINQENLDLWIWLGDFAYVDKH
VGVIMQYVYGQNYLIEDEETRRKKFATTYEDEYYSLLKKQTPVIGIWDDHDYGKNDGDAT
NPIKLNNKQVYLDFLDEPQDSPRRHRGDNTGIYEDYQIKLRKDFSVRIILLDVRFSKTKE
TLLGDDQWKWFENVLKNSNDQVYLLGSGVQFMMRDRLIGAERWPDKEYQRLLDLIKQYKK
SGVFLLSGDVHHSQLLSPKCKLNGLGYELTEITSSGLTHTCDRNLAGLCSYALKGNTPGT
YPISQVVKHQRQRQLNILVEKFQPDKFLVLREFYFKIL