Identifiers and Description

Gene Model Identifier

Contig5906.0.g59

Standard Name

DDXH22

Aliases

Contig5906_0_g59

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL163C4.0017993270483566e-44RAD54 SGDID:S000003131, Chr VI
I from 196403-193707, Gen...
T. thermophilaTTHERM_001938003.000842737734004e-34Type III restriction enzyme, r
es subunit fami...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5906.0.g59(coding)
ATGAGTGCTCTTCTCAATTGAATTCTTATAAACATGAAAATTGTGAAAGATGTAATGATA
GTTTGCCCTACAACCTTAATTGATTATTGGGAGAGGACAGTAGTTTTATGGAACAAGCAT
CAAAATTTGAAGTGCAATAACTTAAGAGACAAGTATAGCAGAGATAATTTATCAAATGAT
GCAATTAGATAAAATAGGAGGCCATTAGTAGTTGTTATATCACCAAACATATATGAGAAA
GAATACAAAAATCTAGAAAAGATGCTTAAAATTGATGTATTAGTGATAGACGAGGGTCAC
AAAGCCAAGAACTAAAATACAAATATTAGAAAAGGGCTGAAATCTATAAAAGTTAATAAA
ATGAAGATTTTGTTGTCTGGCACTCCTGTTCAGAACAACCTAGAGGAACTATTTAGTCTA
TGTGATTTGGTCAAGGATGGAGTTTTTAAGAGTATTGGGTAATTTAAAAAGGAGTTTTGC
ACTCCGATTGAAGATGGATGTAAATCTTATGAAGAGCAAGAAATTTCAAAGGCTTTGACA
CAAGCCACTGAATTGAAAAAACTATACCATCCGCATTTCTTGCGAAGAGTAAAAAGACAA
ATTTTCAGTGTGAGATCTGCTGAGTTACAACCTATTCTGCCACAAGAAACTGCTCTACCC
CTAAAAACAGACTTAGTAGTTTGGGTTAAAATGAGCAAGTTTTAATAGCATGTATACTCT
AAAATAATGAATGAATAGGAAACAAAGGATTGCATCAAGAGAATGCAAAATAAAGACTAG
AAAGGGAGTGTTAGGATCATGGCAATTATTCAAGTTTTAAGGCTTTTATGTGTGCATCCG
TTTTTAACATTTCATGAATTTATAAATAAGGAAAGAAACGTGTAATAAGGTTAAAACTAG
CTATAGAAAAGATAAAGATACGAAGACTCTGATAATGATGATGGTGAAGTTAAATAAAAA
GGAAAGGGAGGAAAAAAAGGGAAAGAAGGCAGTGTTAATTAATCAATGAAAATAGAAAAT
CTATACTAAAATATAAAGAAAAAATTCGAAATTAAAAAATTTTAGGATTGTGTATTTCTG
TTAAGCTCCAAAGTAGCAGGAGTTGGCCTTAATTTAATATCAGCAGATAGAGCTATAATT
TTGGATCCAGACTGGAATCCAGCTACTGATAATTAGTGCATAGATAGACTCTATAGAATA
GGTCAAAGGAAAGATGTGATAGTTTTTAGATTTATAACAGCATGCTCTGTTGAAGAGCAT
ATGTATCGAAGATAGGTACATAAAAGCGGAGTGAGTAATCTAGTAATAGAAAAAGATTGC
TAAAGTATCTAAACATTTTTTGACAAGAAATCCTTGGAATAGCTTCTATTTATAGATCCA
TTTCAAGAACATTGCGATAGTCTTGATATTTTGAATTAAAAACATCAATTTAAAATCGCT
CAGACACCCTCAAATAAACGCACGCTCAAATTTTTTGAAAAAAATGAGCTTGTAATGGGA
TTAAGCAATCATTAGGATATTTTTAAGTCCATTGAGAATTGTGGATATGAGATATAAGCA
GATGAAGATATAGAACGTGATAGAATCTAAATTTTAAAAGAAAAGCTCACTCAAATTAAG
TCTTAAAATCAATAATGA


>Contig5906.0.g59(protein)
MSALLNXILINMKIVKDVMIVCPTTLIDYWERTVVLWNKHQNLKCNNLRDKYSRDNLSND
AIRQNRRPLVVVISPNIYEKEYKNLEKMLKIDVLVIDEGHKAKNQNTNIRKGLKSIKVNK
MKILLSGTPVQNNLEELFSLCDLVKDGVFKSIGQFKKEFCTPIEDGCKSYEEQEISKALT
QATELKKLYHPHFLRRVKRQIFSVRSAELQPILPQETALPLKTDLVVWVKMSKFQQHVYS
KIMNEQETKDCIKRMQNKDQKGSVRIMAIIQVLRLLCVHPFLTFHEFINKERNVQQGQNQ
LQKRQRYEDSDNDDGEVKQKGKGGKKGKEGSVNQSMKIENLYQNIKKKFEIKKFQDCVFL
LSSKVAGVGLNLISADRAIILDPDWNPATDNQCIDRLYRIGQRKDVIVFRFITACSVEEH
MYRRQVHKSGVSNLVIEKDCQSIQTFFDKKSLEQLLFIDPFQEHCDSLDILNQKHQFKIA
QTPSNKRTLKFFEKNELVMGLSNHQDIFKSIENCGYEIQADEDIERDRIQILKEKLTQIK
SQNQQ