Identifiers and Description

Gene Model Identifier

Contig14475.0.0.g26

Standard Name

DDXH21

Aliases

Contig14475_0_0_g26

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002191808.001565848068406e-78DEAD/DEAH box helicase family
protein
SGDYJL033W7.000846320060671e-65HCA4 SGDID:S000003570, Chr X f
rom 383837-386149, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14475.0.0.g26(coding)
ATGCCAGAAACAACTAAACCAGCTAAAAGTCCCAAAAATAACCAGAAGTAGGGAAACAAC
AAAAAAAGAGATAATAAAAATCAGAGAAAGAAGGGAGCGCCAAAGTGGAAAAATGTAGTG
GCTGAAATTGAAGGGTTAAAGAAAAGAATTGCTGAAGAAGTGCCACCTCCAGGTGTATTG
TATTACAAATACAAAGCAAAAGATGAGAATGAAGAGTAAAATCAAGAAGCAGCTGATGAT
TCATCTAAATTAAACACTAAGTCCTCTAGATTGATCGCAAATCGTAAAGTTCTAGAAACA
GACGACAAGACTAAGATTAAAATCAGATTTAGCGACTTGCCAATTTCAAAGGCAACAAAC
AATGGTCTTTACAAAGCTAAGTTTATTAAGATGACAGAAGTTTAGAGGGCAGCCATTTCA
CATGCCATAGCTGGAAGAGATGTAGTAGTGAGTGCTAGAACTGGTAGTGGTAAAACTCTG
AGTTATTTAGTTCCAATTGTCGAAAGACTTTATCATGAGAGATGGAGCAGCATGGATGGC
CTAGGAGCTTTAATTTTAGTGCCAGTAAGAGAGTTAGCTCTTTAAGCTTTTGAAGTTTTG
AGATCATTTGGAGCTTTTCACGATCTGAGTGCTGGACTTGCTATAGGAGGTAAAGACTTG
AATTACGAGCAAGAGAGAATCAGAGGCATGAATATTTTAATATGTACTCCTGGTAGACTT
CTTTAACACATGAATGAAAGTGAAGGCTTGGACACCAGCAACTTGAAGATGCTTGTCATC
GATGAAGTTGACAGAATTCTTGATATGGGATTTAAGGACACTATGGATTGGTAAAATTCT
TAAAGATATGGCAAGAGTTAACTTAAAACCTGA


>Contig14475.0.0.g26(protein)
MPETTKPAKSPKNNQKQGNNKKRDNKNQRKKGAPKWKNVVAEIEGLKKRIAEEVPPPGVL
YYKYKAKDENEEQNQEAADDSSKLNTKSSRLIANRKVLETDDKTKIKIRFSDLPISKATN
NGLYKAKFIKMTEVQRAAISHAIAGRDVVVSARTGSGKTLSYLVPIVERLYHERWSSMDG
LGALILVPVRELALQAFEVLRSFGAFHDLSAGLAIGGKDLNYEQERIRGMNILICTPGRL
LQHMNESEGLDTSNLKMLVIDEVDRILDMGFKDTMDWQNSQRYGKSQLKT