Identifiers and Description

Gene Model Identifier

Contig16125.0.2.g95

Standard Name

DDXH20

Aliases

Contig16125_0_2_g95

Description

ABC transporter

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011514501.9997255150861791e-53ABC transporter family protein
SGDYPL270W9.996273942859018e-26MDL2 SGDID:S000006191, Chr XVI
from 30482-32803, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16125.0.2.g95(coding)
ATGGCTTTAGTCTCGATGGGTGCTACTCCTTTTGTCGTTGTAGGCGCCGTTATTATGTCT
AGACTTTAATGGAGATTGAAAAAGGCTCAAGGTGAGATTAGAGAAAAAGGAGAGATGGAT
CCATATGAACAAGCTAACGCCCTTCTTTCAGATATGCTAATTAATTACAGAACTGTCATC
AGTTTTGGAGACAAAAATGTAGAATATGTTATGAATAGATTCGATAACTTATTGGAAGAA
CCAAACAAGGTTGGTGTTAGAAATGCTCATTTGGCTGGTTTCTGGTTCGGCTACTCTCAA
TGTGTTAGATTCTTCTTCCTTGCCTTTGTGTTCTATATTGCCTCAATCTTCATTTTTGAC
TACGGTGATAAGCCAGATGATACCTATATTGGTTTGTACATTTTGTTCGTTGCAGCTATT
GGAAGTGGAATCTCAATTTCCCAAGCACCATCAGTCTCAAAAGCTCAAAACGCTGCTTCA
AAGGTATTTAACATCATTGAAGAGGAATCAAAGATTGATACTAGATCAACTGAAGGAGAA
AGAATAATCAGCGATGGTGCAATAGAACTTAAGAATGTTCAATTTAGATATCCTTCAAGA
GCCAAAAATGTACTTAATCAAATGAACATGAAAATTCCAGCCACTAAAAAGATCGCACTT
GTTGGTCACTCTGGTTGCGGTAAAAGTACCATCGCTAACCTCTTACTTAGAATGTATGAT
GTCACCGATGGATCGTTTATGATCGATGGAATTGATATTAGAAAGTACAATGTTGGCTAA
CTCAGAAAGCAAATCGGTATTGTTATGCAAGAACCACTACTTTTCAACATGACCATCAAA
TAAAACATCCTCTATGGTAACGATCAAGCTTCTGATTAAAGAGTCAGAGAAGTTGCTGAA
ATGGCAAATGCTCTAGCTTTTATCGAATCAAACATCGAAGACTTGAATCAAGAAGAGGTT
CAAGAAAAGATAGAAGTTTAATACAGAGAATTTATTAACAGAGAAGAAAACAGAAGACGC
TATGCCAACTATTAAGAACTACTCACAAAGTACTTCAATGAAAAAGCTTTCAATATATAA
GAAATTCAACTCATTTTGGAGATTCTTGAGAAAGGTGATGAGAGACTCAGAAATTTGATC
AATGAATATATTCACAGATTTATCAATCTCATTAAGGAAGTTAGTTAATTGAAGGGAATC
AAGTGGGATGATATCGTGCTTAGATTTGAATGGACTTTTGAGGCTGATTACATTTTGGAC
TATCTTAAGAGTGAAGAAGCAACTCAATTCAAGCAAGTCCATAAAGACGCAGTTAATGCT
TTCATTAAATCTCACCCAACTAAATTTGACTTAGTAACAATCAAAGAATTTGGTAAATAA
CTTCAATTCCTTGAAAAGCCAGAGCATAGCATTGAGATATTAAAGAAATTAGTTTCAGAC
AGCTTTGACAGACTTAAGCAACAAAACAATTCTAGAATAAAGTCACTTCATTAATAAAAT
ACATATGCCAAAGACTTCAAGTTACATGAAGGATTTGATAAGAGTTGTGGACTTAAGGGA
TCTATGTTATCAGGTGGTCAGAAGCAAAGAATCGCAATTGCAAGAGCACTCATTAAAGAT
CCAAAGATTCTCATTCTAGATGAAGCTACGTCTGCATTGGATGAGTAATCCCAAGAATTA
GTTCAACAAGCCCTTGATAGAGCTATGGAAGGCAGAACTAGTGTAGTTATTGCTCACAGA
CTAAGTACAGTTAGAAATTGCGAATGGCTCTTTGTCATCCACAATGGAGTAGTAGTTGAA
CAAGGAACTTATGATGAACTCTCCGCAAACTAAAACTCTTATTTCTACAAGCTCAAGTCA
GGCATGGAAATGTGA


>Contig16125.0.2.g95(protein)
MALVSMGATPFVVVGAVIMSRLQWRLKKAQGEIREKGEMDPYEQANALLSDMLINYRTVI
SFGDKNVEYVMNRFDNLLEEPNKVGVRNAHLAGFWFGYSQCVRFFFLAFVFYIASIFIFD
YGDKPDDTYIGLYILFVAAIGSGISISQAPSVSKAQNAASKVFNIIEEESKIDTRSTEGE
RIISDGAIELKNVQFRYPSRAKNVLNQMNMKIPATKKIALVGHSGCGKSTIANLLLRMYD
VTDGSFMIDGIDIRKYNVGQLRKQIGIVMQEPLLFNMTIKQNILYGNDQASDQRVREVAE
MANALAFIESNIEDLNQEEVQEKIEVQYREFINREENRRRYANYQELLTKYFNEKAFNIQ
EIQLILEILEKGDERLRNLINEYIHRFINLIKEVSQLKGIKWDDIVLRFEWTFEADYILD
YLKSEEATQFKQVHKDAVNAFIKSHPTKFDLVTIKEFGKQLQFLEKPEHSIEILKKLVSD
SFDRLKQQNNSRIKSLHQQNTYAKDFKLHEGFDKSCGLKGSMLSGGQKQRIAIARALIKD
PKILILDEATSALDEQSQELVQQALDRAMEGRTSVVIAHRLSTVRNCEWLFVIHNGVVVE
QGTYDELSANQNSYFYKLKSGMEM