Identifiers and Description

Gene Model Identifier

Contig18810.0.g89

Standard Name

DDXH2

Aliases

Contig18810_0_g89

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002415809.999875542736265e-136ATPase, AAA family protein
SGDYDL126C2.0008113830639685e-30CDC48 SGDID:S000002284, Chr IV
from 238664-236157, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18810.0.g89(coding)
ATGAGTGCTGCAGCTTTATTGCTTGGATTTTCAAATGATGAAGTGAAGAATTATTTCGCA
TAGAATTTCATAAATAGATAGTAAGCAGAGTGTGGGAAATTTATGGATAAACATCTTGAG
GGTGCACTTGGACAAATTGAGACTGGCATCAAAGAAATTTAGCAAAAATACCCTGGCATT
TAAAGACCAAACTTAAATTTTGGTTTGAGAGGAACAAGGTACTTCATAGAGTTCCCAATC
ACAGGTAGAAACATTGATGCTTTTAGCATTCTATCTAAAACTCAATAGCTGTTGAAAACT
TCAGAAAATGAATGTGGTTCAAAAGTTATAGCAACTGATAGCTTCACTCAAGATGACAAC
ATTTCTTACATGATTGATTATGCTGTTAATTCTTCAACAGCTCTTGGAGCTAAAAGCAAA
GGAAGTATCTACATTAGAGGTATTAAGGGAGATGGAGGATTTGATTCCTTCAAGTTTGTG
CTTGAAAAAGGGTTTGACTTCCATGAACTTGATGTTTAACTCATTTTGAAGGCATACGAA
GAAGCATTCAAGCCTAAAGCTAACCAATTTGAACAACCAGCAACTATCGGAGATGCTTCA
GTAAAAAAACCTACTAGAAATAGAAATCAACCAGATCCTCAACAAGCAAAAGCAGGATTC
ATAGCAGGTATGGTAGGCAATCCAAATTAATAACAGTAAGATGACACCAGTCCATAAGAG
TCATTGTAGAGATTAGGATGCACAGTCTTCTTACCAGATTAAAAGTAAAATAAGCTAGAC
TGGGATTACTTGGCTGGATATGATAAAGTGAAAAGAGATATAGAAGATACTGTTCTCTTA
GCTCTTACTCATGGACATGTCTATGATCAAATCACTTAAAAAACAAGAATGAAGAATGAA
ACAAACAGACCAAAATGTGTTCTTTTTGAAGGTCCACCAGGCTGTGGTAAAACTACCTCT
GCAAAGATTATATCTTAATAAGTTAACATACCATTGGTTTACATGCCATTAGAAGCAATT
ATGTCTAAGTACTATGGTGAAAGTGAATCAAGACTCGCTGAAATCTTTGAGTCAGCTTAA
GCAATGGGTTCAGTCATTCTTTTTATTGATGAAGTTGATTCATTAGCCACATCGAGAGAG
TCAGGACTTCACGAAGCTACAAGAAGAATTTTGTCTACTCTATTGAGGAAGATTGACAGT
TTTGAGTCTGATGGAGAAGTCTTAGTTATTTGCGCAACTAATAGAAAGAAGGATTTAGAC
CCAGCACTTATTTCCAGACTTGATTTGAACATTAAGTTTGATCTTCCAGATGCTCCTACT
AGAGCAAAAATATTCCAAAGGTATGCCAAGCAACTTACCGAGTAACAACTTAACGAACTT
GCAGAGCTCTCAGTAAACTTATCTGGAAGAGATATCAGTGACATTTGCAAAGATGCTGAG
AGAAAGTGGGCTTCAAAATACATCAGAAAGGAGGTTTCTTCAATCGTACCAGATCTTTCA
GTTTATATTGATAGTGCAAAACACAGAACACATTCAATGCAAGACTCAAACTTAAAAATG
GAAGATAACTCTGGAGAATTTCATGCTAACAGATACCCTCCTAGACCTACTGCTTATGGC
GATGCTTGA


>Contig18810.0.g89(protein)
MSAAALLLGFSNDEVKNYFAQNFINRQQAECGKFMDKHLEGALGQIETGIKEIQQKYPGI
QRPNLNFGLRGTRYFIEFPITGRNIDAFSILSKTQQLLKTSENECGSKVIATDSFTQDDN
ISYMIDYAVNSSTALGAKSKGSIYIRGIKGDGGFDSFKFVLEKGFDFHELDVQLILKAYE
EAFKPKANQFEQPATIGDASVKKPTRNRNQPDPQQAKAGFIAGMVGNPNQQQQDDTSPQE
SLQRLGCTVFLPDQKQNKLDWDYLAGYDKVKRDIEDTVLLALTHGHVYDQITQKTRMKNE
TNRPKCVLFEGPPGCGKTTSAKIISQQVNIPLVYMPLEAIMSKYYGESESRLAEIFESAQ
AMGSVILFIDEVDSLATSRESGLHEATRRILSTLLRKIDSFESDGEVLVICATNRKKDLD
PALISRLDLNIKFDLPDAPTRAKIFQRYAKQLTEQQLNELAELSVNLSGRDISDICKDAE
RKWASKYIRKEVSSIVPDLSVYIDSAKHRTHSMQDSNLKMEDNSGEFHANRYPPRPTAYG
DA